BLASTX nr result
ID: Rehmannia28_contig00040751
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00040751 (357 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080627.1| PREDICTED: pentatricopeptide repeat-containi... 76 6e-14 ref|XP_004516335.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-13 gb|KDO39423.1| hypothetical protein CISIN_1g022131mg [Citrus sin... 74 2e-13 gb|KDO51630.1| hypothetical protein CISIN_1g021829mg [Citrus sin... 74 2e-13 ref|XP_006432131.1| hypothetical protein CICLE_v10000792mg [Citr... 74 4e-13 ref|XP_007198972.1| hypothetical protein PRUPE_ppa015078mg [Prun... 74 5e-13 ref|XP_004306198.1| PREDICTED: pentatricopeptide repeat-containi... 74 5e-13 ref|XP_008229017.1| PREDICTED: pentatricopeptide repeat-containi... 74 5e-13 ref|XP_009354296.1| PREDICTED: pentatricopeptide repeat-containi... 74 5e-13 ref|XP_008342880.1| PREDICTED: pentatricopeptide repeat-containi... 74 5e-13 ref|XP_010258859.1| PREDICTED: pentatricopeptide repeat-containi... 74 5e-13 emb|CDP16451.1| unnamed protein product [Coffea canephora] 74 5e-13 gb|EYU46046.1| hypothetical protein MIMGU_mgv1a005800mg [Erythra... 73 7e-13 ref|XP_002264696.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-13 ref|XP_011011400.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-13 ref|XP_011031143.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-13 ref|XP_002306265.2| hypothetical protein POPTR_0005s06780g [Popu... 73 7e-13 ref|XP_012843972.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-13 gb|KCW62506.1| hypothetical protein EUGRSUZ_H05146 [Eucalyptus g... 73 9e-13 gb|EPS66675.1| hypothetical protein M569_08098, partial [Genlise... 73 1e-12 >ref|XP_011080627.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Sesamum indicum] Length = 540 Score = 76.3 bits (186), Expect = 6e-14 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQKVTFETLYRGLIQADMLRTWRR KKKLEEESI+FG + K P + Sbjct: 491 PQKVTFETLYRGLIQADMLRTWRRLKKKLEEESITFGSEFKEYHLKPYK 539 >ref|XP_004516335.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Cicer arietinum] Length = 512 Score = 75.1 bits (183), Expect = 2e-13 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQKVTFETLYRGLIQADMLRTWRR KKKL+EESI+FG + ++ P R Sbjct: 463 PQKVTFETLYRGLIQADMLRTWRRLKKKLDEESITFGSEFQNYHLKPYR 511 >gb|KDO39423.1| hypothetical protein CISIN_1g022131mg [Citrus sinensis] Length = 302 Score = 73.9 bits (180), Expect = 2e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQKVTFETLYRGLIQ+DMLRTWRR KKKL+EESI+FG + ++ P R Sbjct: 253 PQKVTFETLYRGLIQSDMLRTWRRLKKKLDEESITFGSEFQNYHFKPYR 301 >gb|KDO51630.1| hypothetical protein CISIN_1g021829mg [Citrus sinensis] gi|641832600|gb|KDO51631.1| hypothetical protein CISIN_1g021829mg [Citrus sinensis] Length = 307 Score = 73.9 bits (180), Expect = 2e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQKVTFETLYRGLIQ+DMLRTWRR KKKL+EESI+FG + ++ P R Sbjct: 258 PQKVTFETLYRGLIQSDMLRTWRRLKKKLDEESITFGSEFQNYHFKPYR 306 >ref|XP_006432131.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] gi|567879147|ref|XP_006432132.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] gi|568821248|ref|XP_006465094.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Citrus sinensis] gi|568821250|ref|XP_006465095.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Citrus sinensis] gi|557534253|gb|ESR45371.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] gi|557534254|gb|ESR45372.1| hypothetical protein CICLE_v10000792mg [Citrus clementina] Length = 540 Score = 73.9 bits (180), Expect = 4e-13 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQKVTFETLYRGLIQ+DMLRTWRR KKKL+EESI+FG + ++ P R Sbjct: 491 PQKVTFETLYRGLIQSDMLRTWRRLKKKLDEESITFGSEFQNYHFKPYR 539 >ref|XP_007198972.1| hypothetical protein PRUPE_ppa015078mg [Prunus persica] gi|462394267|gb|EMJ00171.1| hypothetical protein PRUPE_ppa015078mg [Prunus persica] Length = 480 Score = 73.6 bits (179), Expect = 5e-13 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQK+TFETLY+GLIQ+DMLRTWRR KKKL+EESISFG + ++ P R Sbjct: 431 PQKITFETLYKGLIQSDMLRTWRRLKKKLDEESISFGSEFQNYHLKPYR 479 >ref|XP_004306198.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 501 Score = 73.6 bits (179), Expect = 5e-13 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQKVTFETLYRGLIQ+DMLRTWRR KKKL+EES++FG + ++ P R Sbjct: 452 PQKVTFETLYRGLIQSDMLRTWRRLKKKLDEESVTFGAEFQNYHLKPYR 500 >ref|XP_008229017.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Prunus mume] Length = 523 Score = 73.6 bits (179), Expect = 5e-13 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQK+TFETLY+GLIQ+DMLRTWRR KKKL+EESISFG + ++ P R Sbjct: 474 PQKITFETLYKGLIQSDMLRTWRRLKKKLDEESISFGSEFQNYHLKPYR 522 >ref|XP_009354296.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Pyrus x bretschneideri] gi|694326788|ref|XP_009354297.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Pyrus x bretschneideri] Length = 525 Score = 73.6 bits (179), Expect = 5e-13 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQK+TFETLY+GLIQ+DMLRTWRR KKKL+EESISFG + + P R Sbjct: 476 PQKITFETLYKGLIQSDMLRTWRRLKKKLDEESISFGSEFQKYHLKPFR 524 >ref|XP_008342880.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Malus domestica] gi|658015098|ref|XP_008342881.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Malus domestica] Length = 525 Score = 73.6 bits (179), Expect = 5e-13 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQK+TFETLY+GLIQ+DMLRTWRR KKKL+EESISFG + + P R Sbjct: 476 PQKITFETLYKGLIQSDMLRTWRRLKKKLDEESISFGSEFQKYHLKPFR 524 >ref|XP_010258859.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Nelumbo nucifera] gi|720009185|ref|XP_010258860.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Nelumbo nucifera] gi|720009188|ref|XP_010258863.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Nelumbo nucifera] gi|720009191|ref|XP_010258864.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Nelumbo nucifera] Length = 531 Score = 73.6 bits (179), Expect = 5e-13 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQK+TFETLYRGLIQ+DMLRTWRR KKKLEEES++FG + + P R Sbjct: 482 PQKITFETLYRGLIQSDMLRTWRRLKKKLEEESVTFGSEFQRYHFKPYR 530 >emb|CDP16451.1| unnamed protein product [Coffea canephora] Length = 548 Score = 73.6 bits (179), Expect = 5e-13 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQK+TF+TLY+GLIQ+DMLRTWRR KKKLEEESI+FG + +++ P R Sbjct: 499 PQKITFQTLYKGLIQSDMLRTWRRLKKKLEEESITFGSEFETLHLKPYR 547 >gb|EYU46046.1| hypothetical protein MIMGU_mgv1a005800mg [Erythranthe guttata] Length = 470 Score = 73.2 bits (178), Expect = 7e-13 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSP 217 PQK+TFETLYRGLIQADMLRTWRR KKKLEEESI+F + K P Sbjct: 421 PQKITFETLYRGLIQADMLRTWRRLKKKLEEESITFSSEFKEYHLKP 467 >ref|XP_002264696.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial [Vitis vinifera] gi|731387719|ref|XP_010649356.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial [Vitis vinifera] gi|731387721|ref|XP_010649357.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial [Vitis vinifera] gi|296088528|emb|CBI37519.3| unnamed protein product [Vitis vinifera] Length = 525 Score = 73.2 bits (178), Expect = 7e-13 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQK+TFETLYRGLIQ+DML+TWRR KKKLEEESI+FG + + P R Sbjct: 476 PQKITFETLYRGLIQSDMLKTWRRLKKKLEEESITFGSEFQQYHFKPYR 524 >ref|XP_011011400.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Populus euphratica] Length = 548 Score = 73.2 bits (178), Expect = 7e-13 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQKVTFETLY+GLIQ+DMLRTWRR KKKL+EESI+FG + ++ P R Sbjct: 499 PQKVTFETLYKGLIQSDMLRTWRRLKKKLDEESITFGSEFQNYQLKPYR 547 >ref|XP_011031143.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Populus euphratica] Length = 548 Score = 73.2 bits (178), Expect = 7e-13 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQKVTFETLY+GLIQ+DMLRTWRR KKKL+EESI+FG + ++ P R Sbjct: 499 PQKVTFETLYKGLIQSDMLRTWRRLKKKLDEESITFGSEFQNYQLKPYR 547 >ref|XP_002306265.2| hypothetical protein POPTR_0005s06780g [Populus trichocarpa] gi|550338280|gb|EEE93261.2| hypothetical protein POPTR_0005s06780g [Populus trichocarpa] Length = 548 Score = 73.2 bits (178), Expect = 7e-13 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQKVTFETLY+GLIQ+DMLRTWRR KKKL+EESI+FG + ++ P R Sbjct: 499 PQKVTFETLYKGLIQSDMLRTWRRLKKKLDEESITFGSEFQNYQLKPYR 547 >ref|XP_012843972.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13420, mitochondrial-like [Erythranthe guttata] Length = 549 Score = 73.2 bits (178), Expect = 7e-13 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSP 217 PQK+TFETLYRGLIQADMLRTWRR KKKLEEESI+F + K P Sbjct: 500 PQKITFETLYRGLIQADMLRTWRRLKKKLEEESITFSSEFKEYHLKP 546 >gb|KCW62506.1| hypothetical protein EUGRSUZ_H05146 [Eucalyptus grandis] Length = 458 Score = 72.8 bits (177), Expect = 9e-13 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQKVTFETLYRGLIQ+D LRTWRR KKKL+EESI+FG + ++ P R Sbjct: 409 PQKVTFETLYRGLIQSDKLRTWRRLKKKLDEESITFGTEFQNYNLKPYR 457 >gb|EPS66675.1| hypothetical protein M569_08098, partial [Genlisea aurea] Length = 485 Score = 72.8 bits (177), Expect = 1e-12 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -1 Query: 357 PQKVTFETLYRGLIQADMLRTWRRSKKKLEEESISFGWKLKSITSSPIR 211 PQKVTFETLYRGLIQADML+TWRR KKKLE+ES+SF + K P + Sbjct: 436 PQKVTFETLYRGLIQADMLKTWRRLKKKLEDESVSFASEFKEYLLKPYK 484