BLASTX nr result
ID: Rehmannia28_contig00040434
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00040434 (1395 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25877.1| hypothetical protein MIMGU_mgv1a0032851mg, partia... 51 7e-06 >gb|EYU25877.1| hypothetical protein MIMGU_mgv1a0032851mg, partial [Erythranthe guttata] Length = 504 Score = 51.2 bits (121), Expect(2) = 7e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +2 Query: 914 NRSLEMMGDVVGFAVDFSTSVEGIAVLRAKIK 1009 NRS EMMGD V FAVDFSTS+E IA LRAKIK Sbjct: 472 NRSPEMMGDAVEFAVDFSTSIETIAALRAKIK 503 Score = 28.1 bits (61), Expect(2) = 7e-06 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = +3 Query: 843 LKANNKKVYKFKSVLATKPMNN 908 LK +N+KVY SVLA KP++N Sbjct: 449 LKPDNEKVYYPNSVLAIKPISN 470