BLASTX nr result
ID: Rehmannia28_contig00040136
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00040136 (361 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27962.1| hypothetical protein MIMGU_mgv1a006121mg [Erythra... 62 8e-09 ref|XP_012848817.1| PREDICTED: LOW QUALITY PROTEIN: allantoinase... 62 8e-09 ref|XP_011096296.1| PREDICTED: allantoinase [Sesamum indicum] 59 1e-07 >gb|EYU27962.1| hypothetical protein MIMGU_mgv1a006121mg [Erythranthe guttata] Length = 456 Score = 61.6 bits (148), Expect = 8e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -1 Query: 109 MLMRCIKIFPQTYRSNCSLIQYRHFWIASKRIVTPS 2 +++ FPQ+YRSNCSLIQYRHFWIASKRIVTP+ Sbjct: 18 LILLYFDFFPQSYRSNCSLIQYRHFWIASKRIVTPT 53 >ref|XP_012848817.1| PREDICTED: LOW QUALITY PROTEIN: allantoinase [Erythranthe guttata] Length = 496 Score = 61.6 bits (148), Expect = 8e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -1 Query: 109 MLMRCIKIFPQTYRSNCSLIQYRHFWIASKRIVTPS 2 +++ FPQ+YRSNCSLIQYRHFWIASKRIVTP+ Sbjct: 18 LILLYFDFFPQSYRSNCSLIQYRHFWIASKRIVTPT 53 >ref|XP_011096296.1| PREDICTED: allantoinase [Sesamum indicum] Length = 500 Score = 58.5 bits (140), Expect = 1e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -1 Query: 109 MLMRCIKIFPQTYRSNCSLIQYRHFWIASKRIVTPS 2 +++ IFPQ+YR+ CSLI+YRH+WIASKRIVTPS Sbjct: 18 LILLYFDIFPQSYRTRCSLIEYRHYWIASKRIVTPS 53