BLASTX nr result
ID: Rehmannia28_contig00039859
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00039859 (400 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095185.1| PREDICTED: single-stranded DNA-bindig protei... 113 1e-28 ref|XP_012854973.1| PREDICTED: single-stranded DNA-bindig protei... 103 7e-25 gb|KVI07448.1| Plant transcription factor [Cynara cardunculus va... 82 2e-17 ref|XP_009772788.1| PREDICTED: single-stranded DNA-bindig protei... 83 7e-17 ref|XP_009772779.1| PREDICTED: single-stranded DNA-bindig protei... 83 7e-17 ref|XP_009598358.1| PREDICTED: single-stranded DNA-bindig protei... 83 7e-17 emb|CDP11529.1| unnamed protein product [Coffea canephora] 76 2e-15 ref|XP_009772771.1| PREDICTED: single-stranded DNA-bindig protei... 78 4e-15 ref|XP_009598357.1| PREDICTED: single-stranded DNA-bindig protei... 78 4e-15 ref|XP_009598355.1| PREDICTED: single-stranded DNA-bindig protei... 78 4e-15 ref|XP_015166242.1| PREDICTED: single-stranded DNA-bindig protei... 78 4e-15 ref|XP_007019694.1| Whirly 2, putative isoform 2 [Theobroma caca... 75 3e-14 ref|XP_006390787.1| hypothetical protein EUTSA_v10019058mg [Eutr... 76 3e-14 ref|XP_006390788.1| hypothetical protein EUTSA_v10019058mg [Eutr... 76 3e-14 gb|KDO51400.1| hypothetical protein CISIN_1g026312mg [Citrus sin... 74 4e-14 ref|XP_015056794.1| PREDICTED: single-stranded DNA-bindig protei... 75 4e-14 ref|XP_015056792.1| PREDICTED: single-stranded DNA-bindig protei... 75 4e-14 ref|XP_004250750.2| PREDICTED: single-stranded DNA-bindig protei... 75 4e-14 gb|KDO51397.1| hypothetical protein CISIN_1g026312mg [Citrus sin... 74 4e-14 ref|XP_007019693.1| Whirly 2, putative isoform 1 [Theobroma caca... 75 5e-14 >ref|XP_011095185.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial [Sesamum indicum] Length = 239 Score = 113 bits (283), Expect = 1e-28 Identities = 58/76 (76%), Positives = 61/76 (80%) Frame = -2 Query: 228 ATNDFKLLRGITTQTGMSTAMPKFGSDGKPTARTFAPYSIYKGKAALSADPLLPMFSQLE 49 AT DFKLLRGITTQT MS+AM DG + FAPYSIYKGKAALSADP LP FS+LE Sbjct: 25 ATGDFKLLRGITTQTVMSSAMQSSARDGNSAVKIFAPYSIYKGKAALSADPRLPTFSKLE 84 Query: 48 SGDYRVERRGVIMLTF 1 SG YRVERRGVIMLTF Sbjct: 85 SGGYRVERRGVIMLTF 100 >ref|XP_012854973.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial [Erythranthe guttata] gi|604303222|gb|EYU22695.1| hypothetical protein MIMGU_mgv1a012912mg [Erythranthe guttata] Length = 236 Score = 103 bits (257), Expect = 7e-25 Identities = 54/79 (68%), Positives = 62/79 (78%) Frame = -2 Query: 237 VGAATNDFKLLRGITTQTGMSTAMPKFGSDGKPTARTFAPYSIYKGKAALSADPLLPMFS 58 V AT D KLLRG+TTQ+G+ST GK A+ FAPYSIYKGKAALSADPLLPMF+ Sbjct: 23 VSEATIDLKLLRGLTTQSGIST--------GKSAAKVFAPYSIYKGKAALSADPLLPMFT 74 Query: 57 QLESGDYRVERRGVIMLTF 1 +L+SG Y+VERRG IMLTF Sbjct: 75 KLQSGGYKVERRGSIMLTF 93 >gb|KVI07448.1| Plant transcription factor [Cynara cardunculus var. scolymus] Length = 129 Score = 81.6 bits (200), Expect = 2e-17 Identities = 43/74 (58%), Positives = 55/74 (74%) Frame = -2 Query: 222 NDFKLLRGITTQTGMSTAMPKFGSDGKPTARTFAPYSIYKGKAALSADPLLPMFSQLESG 43 N FKL ++ G+ST+ +G+DGK + R FA YSI+KGKAALSA P+LP FS+L+SG Sbjct: 31 NCFKLT---SSAAGISTSRQSYGADGKISGRIFADYSIFKGKAALSAAPVLPTFSKLDSG 87 Query: 42 DYRVERRGVIMLTF 1 +VERRG IMLTF Sbjct: 88 YTKVERRGTIMLTF 101 >ref|XP_009772788.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X3 [Nicotiana sylvestris] Length = 239 Score = 82.8 bits (203), Expect = 7e-17 Identities = 42/78 (53%), Positives = 50/78 (64%) Frame = -2 Query: 234 GAATNDFKLLRGITTQTGMSTAMPKFGSDGKPTARTFAPYSIYKGKAALSADPLLPMFSQ 55 G D I T G ST +DGK T R FAPYS++KGKAALSA+P LP FS+ Sbjct: 23 GEGVRDSIWQHAINTLAGFSTVRQNIVADGKLTGRVFAPYSVFKGKAALSAEPRLPTFSK 82 Query: 54 LESGDYRVERRGVIMLTF 1 L+SG ++ RRGVIMLTF Sbjct: 83 LDSGGVKLNRRGVIMLTF 100 >ref|XP_009772779.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X2 [Nicotiana sylvestris] Length = 240 Score = 82.8 bits (203), Expect = 7e-17 Identities = 42/78 (53%), Positives = 50/78 (64%) Frame = -2 Query: 234 GAATNDFKLLRGITTQTGMSTAMPKFGSDGKPTARTFAPYSIYKGKAALSADPLLPMFSQ 55 G D I T G ST +DGK T R FAPYS++KGKAALSA+P LP FS+ Sbjct: 24 GEGVRDSIWQHAINTLAGFSTVRQNIVADGKLTGRVFAPYSVFKGKAALSAEPRLPTFSK 83 Query: 54 LESGDYRVERRGVIMLTF 1 L+SG ++ RRGVIMLTF Sbjct: 84 LDSGGVKLNRRGVIMLTF 101 >ref|XP_009598358.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X3 [Nicotiana tomentosiformis] Length = 240 Score = 82.8 bits (203), Expect = 7e-17 Identities = 42/78 (53%), Positives = 50/78 (64%) Frame = -2 Query: 234 GAATNDFKLLRGITTQTGMSTAMPKFGSDGKPTARTFAPYSIYKGKAALSADPLLPMFSQ 55 G D I T G ST +DGK T R FAPYS++KGKAALSA+P LP FS+ Sbjct: 24 GEGVRDSIWQHAINTLAGFSTVRQNIVADGKLTGRVFAPYSVFKGKAALSAEPRLPTFSK 83 Query: 54 LESGDYRVERRGVIMLTF 1 L+SG ++ RRGVIMLTF Sbjct: 84 LDSGGVKLNRRGVIMLTF 101 >emb|CDP11529.1| unnamed protein product [Coffea canephora] Length = 132 Score = 76.3 bits (186), Expect = 2e-15 Identities = 36/64 (56%), Positives = 47/64 (73%) Frame = -2 Query: 192 TQTGMSTAMPKFGSDGKPTARTFAPYSIYKGKAALSADPLLPMFSQLESGDYRVERRGVI 13 TQ+G STA F +DG T + FA YS+YKGKAALS P+LP F +L+SG +++R+G I Sbjct: 38 TQSGTSTARQSFVADGSMTDKIFASYSVYKGKAALSTSPMLPTFRKLDSGGVKLDRKGSI 97 Query: 12 MLTF 1 MLTF Sbjct: 98 MLTF 101 >ref|XP_009772771.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X1 [Nicotiana sylvestris] Length = 240 Score = 78.2 bits (191), Expect = 4e-15 Identities = 42/79 (53%), Positives = 50/79 (63%), Gaps = 1/79 (1%) Frame = -2 Query: 234 GAATNDFKLLRGITTQTGMSTAMPKFGSD-GKPTARTFAPYSIYKGKAALSADPLLPMFS 58 G D I T G ST +D GK T R FAPYS++KGKAALSA+P LP FS Sbjct: 23 GEGVRDSIWQHAINTLAGFSTVRQNIVADAGKLTGRVFAPYSVFKGKAALSAEPRLPTFS 82 Query: 57 QLESGDYRVERRGVIMLTF 1 +L+SG ++ RRGVIMLTF Sbjct: 83 KLDSGGVKLNRRGVIMLTF 101 >ref|XP_009598357.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X2 [Nicotiana tomentosiformis] Length = 240 Score = 78.2 bits (191), Expect = 4e-15 Identities = 42/79 (53%), Positives = 50/79 (63%), Gaps = 1/79 (1%) Frame = -2 Query: 234 GAATNDFKLLRGITTQTGMSTAMPKFGSD-GKPTARTFAPYSIYKGKAALSADPLLPMFS 58 G D I T G ST +D GK T R FAPYS++KGKAALSA+P LP FS Sbjct: 23 GEGVRDSIWQHAINTLAGFSTVRQNIVADAGKLTGRVFAPYSVFKGKAALSAEPRLPTFS 82 Query: 57 QLESGDYRVERRGVIMLTF 1 +L+SG ++ RRGVIMLTF Sbjct: 83 KLDSGGVKLNRRGVIMLTF 101 >ref|XP_009598355.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X1 [Nicotiana tomentosiformis] Length = 241 Score = 78.2 bits (191), Expect = 4e-15 Identities = 42/79 (53%), Positives = 50/79 (63%), Gaps = 1/79 (1%) Frame = -2 Query: 234 GAATNDFKLLRGITTQTGMSTAMPKFGSD-GKPTARTFAPYSIYKGKAALSADPLLPMFS 58 G D I T G ST +D GK T R FAPYS++KGKAALSA+P LP FS Sbjct: 24 GEGVRDSIWQHAINTLAGFSTVRQNIVADAGKLTGRVFAPYSVFKGKAALSAEPRLPTFS 83 Query: 57 QLESGDYRVERRGVIMLTF 1 +L+SG ++ RRGVIMLTF Sbjct: 84 KLDSGGVKLNRRGVIMLTF 102 >ref|XP_015166242.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X2 [Solanum tuberosum] Length = 243 Score = 78.2 bits (191), Expect = 4e-15 Identities = 38/66 (57%), Positives = 47/66 (71%) Frame = -2 Query: 198 ITTQTGMSTAMPKFGSDGKPTARTFAPYSIYKGKAALSADPLLPMFSQLESGDYRVERRG 19 I T G ST +DGK R FAPYS++KGKAALSA+P LP F++L+SG ++ RRG Sbjct: 33 INTFAGFSTVRQNVVADGKREGRVFAPYSVFKGKAALSAEPRLPTFNRLDSGGVKLNRRG 92 Query: 18 VIMLTF 1 VIMLTF Sbjct: 93 VIMLTF 98 >ref|XP_007019694.1| Whirly 2, putative isoform 2 [Theobroma cacao] gi|508725022|gb|EOY16919.1| Whirly 2, putative isoform 2 [Theobroma cacao] Length = 198 Score = 75.1 bits (183), Expect = 3e-14 Identities = 33/64 (51%), Positives = 48/64 (75%) Frame = -2 Query: 192 TQTGMSTAMPKFGSDGKPTARTFAPYSIYKGKAALSADPLLPMFSQLESGDYRVERRGVI 13 ++ +ST++ F S G TAR APY++YKGKAA S PLLP FS+++SG+ +++RRG + Sbjct: 34 SRAAISTSIHDFASKGNSTARVIAPYTVYKGKAAFSVTPLLPTFSKIDSGNLKLDRRGAM 93 Query: 12 MLTF 1 MLTF Sbjct: 94 MLTF 97 >ref|XP_006390787.1| hypothetical protein EUTSA_v10019058mg [Eutrema salsugineum] gi|557087221|gb|ESQ28073.1| hypothetical protein EUTSA_v10019058mg [Eutrema salsugineum] Length = 240 Score = 75.9 bits (185), Expect = 3e-14 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 2/71 (2%) Frame = -2 Query: 207 LRGITTQTGMSTAMPKF-GSDG-KPTARTFAPYSIYKGKAALSADPLLPMFSQLESGDYR 34 LRG T+ ST+ F G D KP+ R FAPY+I+KGKAALS +P+LP F+++E G+ R Sbjct: 30 LRGFATRADSSTSARGFSGKDAAKPSGRVFAPYAIFKGKAALSVEPVLPTFARIEPGNLR 89 Query: 33 VERRGVIMLTF 1 ++RRG +M+TF Sbjct: 90 IDRRGSVMMTF 100 >ref|XP_006390788.1| hypothetical protein EUTSA_v10019058mg [Eutrema salsugineum] gi|557087222|gb|ESQ28074.1| hypothetical protein EUTSA_v10019058mg [Eutrema salsugineum] Length = 241 Score = 75.9 bits (185), Expect = 3e-14 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 2/71 (2%) Frame = -2 Query: 207 LRGITTQTGMSTAMPKF-GSDG-KPTARTFAPYSIYKGKAALSADPLLPMFSQLESGDYR 34 LRG T+ ST+ F G D KP+ R FAPY+I+KGKAALS +P+LP F+++E G+ R Sbjct: 31 LRGFATRADSSTSARGFSGKDAAKPSGRVFAPYAIFKGKAALSVEPVLPTFARIEPGNLR 90 Query: 33 VERRGVIMLTF 1 ++RRG +M+TF Sbjct: 91 IDRRGSVMMTF 101 >gb|KDO51400.1| hypothetical protein CISIN_1g026312mg [Citrus sinensis] Length = 178 Score = 74.3 bits (181), Expect = 4e-14 Identities = 35/66 (53%), Positives = 46/66 (69%) Frame = -2 Query: 198 ITTQTGMSTAMPKFGSDGKPTARTFAPYSIYKGKAALSADPLLPMFSQLESGDYRVERRG 19 + +Q GMST + G R FAPY +YKGKAA S DP+LP F +L+SGD +V+R+G Sbjct: 36 LISQAGMSTTGHDVSAKGSLGGRIFAPYYVYKGKAAFSVDPVLPTFMKLDSGDLKVKRKG 95 Query: 18 VIMLTF 1 VI+LTF Sbjct: 96 VILLTF 101 >ref|XP_015056794.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X4 [Solanum pennellii] Length = 237 Score = 75.5 bits (184), Expect = 4e-14 Identities = 37/66 (56%), Positives = 46/66 (69%) Frame = -2 Query: 198 ITTQTGMSTAMPKFGSDGKPTARTFAPYSIYKGKAALSADPLLPMFSQLESGDYRVERRG 19 I T ST +DGK R FAPYS++KGKAALSA+P LP F++L+SG ++ RRG Sbjct: 33 INTFAAFSTVRQDVVADGKREGRVFAPYSVFKGKAALSAEPRLPTFNRLDSGGVKLNRRG 92 Query: 18 VIMLTF 1 VIMLTF Sbjct: 93 VIMLTF 98 >ref|XP_015056792.1| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X2 [Solanum pennellii] Length = 240 Score = 75.5 bits (184), Expect = 4e-14 Identities = 37/66 (56%), Positives = 46/66 (69%) Frame = -2 Query: 198 ITTQTGMSTAMPKFGSDGKPTARTFAPYSIYKGKAALSADPLLPMFSQLESGDYRVERRG 19 I T ST +DGK R FAPYS++KGKAALSA+P LP F++L+SG ++ RRG Sbjct: 36 INTFAAFSTVRQDVVADGKREGRVFAPYSVFKGKAALSAEPRLPTFNRLDSGGVKLNRRG 95 Query: 18 VIMLTF 1 VIMLTF Sbjct: 96 VIMLTF 101 >ref|XP_004250750.2| PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial isoform X2 [Solanum lycopersicum] Length = 240 Score = 75.5 bits (184), Expect = 4e-14 Identities = 37/66 (56%), Positives = 46/66 (69%) Frame = -2 Query: 198 ITTQTGMSTAMPKFGSDGKPTARTFAPYSIYKGKAALSADPLLPMFSQLESGDYRVERRG 19 I T ST +DGK R FAPYS++KGKAALSA+P LP F++L+SG ++ RRG Sbjct: 36 INTFAAFSTVRQDVVADGKREGRVFAPYSVFKGKAALSAEPRLPTFNRLDSGGVKLNRRG 95 Query: 18 VIMLTF 1 VIMLTF Sbjct: 96 VIMLTF 101 >gb|KDO51397.1| hypothetical protein CISIN_1g026312mg [Citrus sinensis] Length = 183 Score = 74.3 bits (181), Expect = 4e-14 Identities = 35/66 (53%), Positives = 46/66 (69%) Frame = -2 Query: 198 ITTQTGMSTAMPKFGSDGKPTARTFAPYSIYKGKAALSADPLLPMFSQLESGDYRVERRG 19 + +Q GMST + G R FAPY +YKGKAA S DP+LP F +L+SGD +V+R+G Sbjct: 36 LISQAGMSTTGHDVSAKGSLGGRIFAPYYVYKGKAAFSVDPVLPTFMKLDSGDLKVKRKG 95 Query: 18 VIMLTF 1 VI+LTF Sbjct: 96 VILLTF 101 >ref|XP_007019693.1| Whirly 2, putative isoform 1 [Theobroma cacao] gi|508725021|gb|EOY16918.1| Whirly 2, putative isoform 1 [Theobroma cacao] Length = 236 Score = 75.1 bits (183), Expect = 5e-14 Identities = 33/64 (51%), Positives = 48/64 (75%) Frame = -2 Query: 192 TQTGMSTAMPKFGSDGKPTARTFAPYSIYKGKAALSADPLLPMFSQLESGDYRVERRGVI 13 ++ +ST++ F S G TAR APY++YKGKAA S PLLP FS+++SG+ +++RRG + Sbjct: 34 SRAAISTSIHDFASKGNSTARVIAPYTVYKGKAAFSVTPLLPTFSKIDSGNLKLDRRGAM 93 Query: 12 MLTF 1 MLTF Sbjct: 94 MLTF 97