BLASTX nr result
ID: Rehmannia28_contig00039327
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00039327 (315 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853402.1| PREDICTED: ABC transporter G family member 1... 53 6e-06 >ref|XP_012853402.1| PREDICTED: ABC transporter G family member 11-like [Erythranthe guttata] gi|604304711|gb|EYU23962.1| hypothetical protein MIMGU_mgv1a002102mg [Erythranthe guttata] Length = 714 Score = 52.8 bits (125), Expect = 6e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -2 Query: 116 PVNAPRWTPSPNPTSRLIKEPVISHDPDYISDSFASS 6 P+N PRWTPS +P++ LI +PVISH DY SDSFASS Sbjct: 5 PINVPRWTPSSSPSANLIIKPVISH--DYGSDSFASS 39