BLASTX nr result
ID: Rehmannia28_contig00039133
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00039133 (419 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098361.1| PREDICTED: uncharacterized WD repeat-contain... 74 6e-13 ref|XP_011098343.1| PREDICTED: uncharacterized WD repeat-contain... 74 7e-13 ref|XP_011098335.1| PREDICTED: uncharacterized WD repeat-contain... 74 7e-13 >ref|XP_011098361.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X4 [Sesamum indicum] Length = 388 Score = 73.9 bits (180), Expect = 6e-13 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 117 ALDAGLQFYLSSWRIRDHFHMLRNLLWATSKHDVYLPQN 1 A++AGLQFYLSSWR +D FHMLRNLLWATSKHDVYL QN Sbjct: 55 AIEAGLQFYLSSWRNKDTFHMLRNLLWATSKHDVYLMQN 93 >ref|XP_011098343.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X2 [Sesamum indicum] Length = 489 Score = 73.9 bits (180), Expect = 7e-13 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 117 ALDAGLQFYLSSWRIRDHFHMLRNLLWATSKHDVYLPQN 1 A++AGLQFYLSSWR +D FHMLRNLLWATSKHDVYL QN Sbjct: 156 AIEAGLQFYLSSWRNKDTFHMLRNLLWATSKHDVYLMQN 194 >ref|XP_011098335.1| PREDICTED: uncharacterized WD repeat-containing protein C2A9.03-like isoform X1 [Sesamum indicum] Length = 490 Score = 73.9 bits (180), Expect = 7e-13 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 117 ALDAGLQFYLSSWRIRDHFHMLRNLLWATSKHDVYLPQN 1 A++AGLQFYLSSWR +D FHMLRNLLWATSKHDVYL QN Sbjct: 157 AIEAGLQFYLSSWRNKDTFHMLRNLLWATSKHDVYLMQN 195