BLASTX nr result
ID: Rehmannia28_contig00038999
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00038999 (356 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31719.1| hypothetical protein MIMGU_mgv1a022351mg, partial... 50 1e-05 >gb|EYU31719.1| hypothetical protein MIMGU_mgv1a022351mg, partial [Erythranthe guttata] Length = 115 Score = 50.4 bits (119), Expect = 1e-05 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = -2 Query: 118 DTLGSFLCLED*AMLYKKCEISTHKVRPFWATHQRILL 5 +TLG F CLED +L ++C+ISTHK RPF + H R+LL Sbjct: 60 ETLGWFFCLEDRVVLCRQCDISTHKSRPFGSGHHRLLL 97