BLASTX nr result
ID: Rehmannia28_contig00038914
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00038914 (442 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094832.1| PREDICTED: pentatricopeptide repeat-containi... 74 1e-12 >ref|XP_011094832.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Sesamum indicum] gi|747094012|ref|XP_011094833.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Sesamum indicum] Length = 768 Score = 73.6 bits (179), Expect = 1e-12 Identities = 44/101 (43%), Positives = 46/101 (45%), Gaps = 13/101 (12%) Frame = +1 Query: 178 MAFSSCLKCLPCFPSHNLNH-------------TSFPFPRIYVEQPXXXXXXXXXXXXXX 318 MAFSSCLKC P PSHN N TS PFPRI V QP Sbjct: 1 MAFSSCLKCHPWAPSHNPNLPFLFHQNSEPAKVTSLPFPRINVRQPSGLSCAVSSGLSSI 60 Query: 319 XXXPDFXXXXXXXXXXXXXXXXSALRLFQWASKKPNFAPTL 441 PDF SALR+FQWASK+PNF PTL Sbjct: 61 SLSPDFSPKQLLDTLRCEENETSALRIFQWASKQPNFVPTL 101