BLASTX nr result
ID: Rehmannia28_contig00038790
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00038790 (305 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17920.1| hypothetical protein MIMGU_mgv1a006934mg [Erythra... 89 1e-18 ref|XP_012828922.1| PREDICTED: legumin B-like [Erythranthe guttata] 89 1e-18 ref|XP_011083024.1| PREDICTED: legumin B-like [Sesamum indicum] 88 2e-18 ref|XP_012831261.1| PREDICTED: legumin B [Erythranthe guttata] g... 87 5e-18 gb|ABB60055.1| 11S globulin precursor isoform 4 [Sesamum indicum] 86 9e-18 ref|XP_009624043.1| PREDICTED: legumin A-like [Nicotiana tomento... 75 8e-14 ref|XP_011080043.1| PREDICTED: legumin B-like [Sesamum indicum] 74 1e-13 ref|XP_009803568.1| PREDICTED: legumin A-like [Nicotiana sylvest... 74 2e-13 gb|EPS62256.1| hypothetical protein M569_12535, partial [Genlise... 74 3e-13 ref|XP_009761685.1| PREDICTED: legumin A-like [Nicotiana sylvest... 73 5e-13 ref|XP_009624041.1| PREDICTED: legumin A-like [Nicotiana tomento... 73 5e-13 ref|XP_009763034.1| PREDICTED: legumin B-like [Nicotiana sylvest... 73 5e-13 gb|KVH94293.1| 11-S seed storage protein, conserved site-contain... 71 2e-12 ref|XP_006351673.1| PREDICTED: legumin B-like [Solanum tuberosum] 71 2e-12 ref|XP_004246943.1| PREDICTED: 12S seed storage protein CRA1-lik... 70 5e-12 ref|XP_015086518.1| PREDICTED: 12S seed storage protein CRA1-lik... 69 1e-11 gb|KVE34071.1| 11-S seed storage protein, plant, partial [Cynara... 67 2e-11 gb|ABB77213.1| 11S globulin-like protein [Actinidia chinensis] 68 3e-11 gb|AGU36588.1| 11S globulin precursor, partial [Helianthus annuus] 65 4e-11 gb|AGU36580.1| 11S globulin precursor, partial [Helianthus annuus] 65 4e-11 >gb|EYU17920.1| hypothetical protein MIMGU_mgv1a006934mg [Erythranthe guttata] Length = 425 Score = 88.6 bits (218), Expect = 1e-18 Identities = 39/49 (79%), Positives = 47/49 (95%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPPL 93 N+FRGFDV+TL++VFGVD+ETAR LQGENDERGH+I V++GLQVITPPL Sbjct: 227 NVFRGFDVQTLAEVFGVDEETARKLQGENDERGHLIIVERGLQVITPPL 275 >ref|XP_012828922.1| PREDICTED: legumin B-like [Erythranthe guttata] Length = 478 Score = 88.6 bits (218), Expect = 1e-18 Identities = 39/49 (79%), Positives = 47/49 (95%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPPL 93 N+FRGFDV+TL++VFGVD+ETAR LQGENDERGH+I V++GLQVITPPL Sbjct: 225 NVFRGFDVQTLAEVFGVDEETARKLQGENDERGHLIIVERGLQVITPPL 273 >ref|XP_011083024.1| PREDICTED: legumin B-like [Sesamum indicum] Length = 460 Score = 88.2 bits (217), Expect = 2e-18 Identities = 40/49 (81%), Positives = 47/49 (95%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPPL 93 N+FRGFDV+ LS+VFGVD++TARSLQGENDERGHIITV +GLQVI+PPL Sbjct: 214 NVFRGFDVQILSEVFGVDEQTARSLQGENDERGHIITVARGLQVISPPL 262 >ref|XP_012831261.1| PREDICTED: legumin B [Erythranthe guttata] gi|604348300|gb|EYU46455.1| hypothetical protein MIMGU_mgv1a005708mg [Erythranthe guttata] Length = 473 Score = 87.0 bits (214), Expect = 5e-18 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPPL 93 NIFRGFDVETL++VFGVD+ETAR LQG NDERGH+I VQ+GLQVI PPL Sbjct: 218 NIFRGFDVETLAEVFGVDEETARKLQGHNDERGHLILVQRGLQVIRPPL 266 >gb|ABB60055.1| 11S globulin precursor isoform 4 [Sesamum indicum] Length = 469 Score = 86.3 bits (212), Expect = 9e-18 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPPL 93 N+FRGFDV+ LS+VFGVD++ ARSLQGENDERGHIITV +GLQVI+PPL Sbjct: 214 NVFRGFDVQILSEVFGVDEQAARSLQGENDERGHIITVARGLQVISPPL 262 >ref|XP_009624043.1| PREDICTED: legumin A-like [Nicotiana tomentosiformis] Length = 475 Score = 75.1 bits (183), Expect = 8e-14 Identities = 30/50 (60%), Positives = 42/50 (84%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPPLT 90 N+F GFDV+ L++ FGVDQETAR LQG+ D+RGHI+ +Q+GL+V+ PP + Sbjct: 217 NVFNGFDVQVLAEAFGVDQETARRLQGQEDQRGHIVNIQQGLRVVRPPFS 266 >ref|XP_011080043.1| PREDICTED: legumin B-like [Sesamum indicum] Length = 464 Score = 74.3 bits (181), Expect = 1e-13 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPP 96 N+FRGFDV L++VFGVD+ETAR LQGE+D RGHI+ V+ GL VI PP Sbjct: 210 NVFRGFDVHMLTEVFGVDEETARRLQGEHDTRGHIVIVEHGLHVIRPP 257 >ref|XP_009803568.1| PREDICTED: legumin A-like [Nicotiana sylvestris] Length = 475 Score = 73.9 bits (180), Expect = 2e-13 Identities = 29/50 (58%), Positives = 42/50 (84%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPPLT 90 N+F GFDV+ L++ FGVDQETA+ LQG+ D+RGHI+ +Q+GL+V+ PP + Sbjct: 217 NVFNGFDVQVLAEAFGVDQETAKRLQGQEDQRGHIVNIQQGLRVVRPPFS 266 >gb|EPS62256.1| hypothetical protein M569_12535, partial [Genlisea aurea] Length = 476 Score = 73.6 bits (179), Expect = 3e-13 Identities = 31/48 (64%), Positives = 42/48 (87%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPP 96 N+FRGFD + LS++F VD+ETAR LQGE++ RGHIITV++ LQV++PP Sbjct: 215 NVFRGFDAQWLSEIFQVDEETARKLQGEDENRGHIITVERSLQVLSPP 262 >ref|XP_009761685.1| PREDICTED: legumin A-like [Nicotiana sylvestris] Length = 473 Score = 72.8 bits (177), Expect = 5e-13 Identities = 29/50 (58%), Positives = 42/50 (84%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPPLT 90 N+F GFDVE L++ FGVD+E AR LQG++D+RGHI+ +Q+GL+V+ PP + Sbjct: 215 NVFNGFDVEVLAEAFGVDREIARRLQGQDDQRGHIVNIQQGLRVVRPPFS 264 >ref|XP_009624041.1| PREDICTED: legumin A-like [Nicotiana tomentosiformis] Length = 473 Score = 72.8 bits (177), Expect = 5e-13 Identities = 29/50 (58%), Positives = 42/50 (84%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPPLT 90 N+F GFDVE L++ FGVD+E AR LQG++D+RGHI+ +Q+GL+V+ PP + Sbjct: 215 NVFNGFDVEVLAEAFGVDREIARRLQGQDDQRGHIVNIQQGLRVVRPPFS 264 >ref|XP_009763034.1| PREDICTED: legumin B-like [Nicotiana sylvestris] Length = 483 Score = 72.8 bits (177), Expect = 5e-13 Identities = 31/50 (62%), Positives = 42/50 (84%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPPLT 90 N+F GFD+E LS+ FGVD+E AR LQG++D RGHI++VQ+GL+VI PP + Sbjct: 215 NVFNGFDIEILSEAFGVDREMARRLQGQDDMRGHIVSVQEGLRVIRPPFS 264 >gb|KVH94293.1| 11-S seed storage protein, conserved site-containing protein [Cynara cardunculus var. scolymus] Length = 402 Score = 70.9 bits (172), Expect = 2e-12 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPPLT 90 +IFRGFD++ LS F VD ETA+ LQ D RGHI+TVQKGLQVI PP++ Sbjct: 194 DIFRGFDLQILSDAFNVDHETAQKLQSPGDNRGHIVTVQKGLQVIKPPVS 243 >ref|XP_006351673.1| PREDICTED: legumin B-like [Solanum tuberosum] Length = 474 Score = 70.9 bits (172), Expect = 2e-12 Identities = 28/50 (56%), Positives = 41/50 (82%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPPLT 90 N+FRGF++E L++ FGV +ETAR LQGE D+RGHI+ + +GL+V+ PP + Sbjct: 216 NVFRGFELELLAEAFGVSKETARKLQGEEDQRGHIVNIDQGLRVVRPPFS 265 >ref|XP_004246943.1| PREDICTED: 12S seed storage protein CRA1-like [Solanum lycopersicum] Length = 474 Score = 70.1 bits (170), Expect = 5e-12 Identities = 28/50 (56%), Positives = 40/50 (80%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPPLT 90 N+FRGF++E L++ FGV ETAR LQGE D+RGHI+ + +GL+V+ PP + Sbjct: 216 NVFRGFELELLAEAFGVSTETARKLQGEEDQRGHIVNIDQGLRVVRPPFS 265 >ref|XP_015086518.1| PREDICTED: 12S seed storage protein CRA1-like [Solanum pennellii] Length = 474 Score = 68.9 bits (167), Expect = 1e-11 Identities = 27/50 (54%), Positives = 40/50 (80%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPPLT 90 N+FRGF++E L++ FGV ETAR LQG+ D+RGHI+ + +GL+V+ PP + Sbjct: 216 NVFRGFELELLAEAFGVSTETARKLQGQEDQRGHIVNIDQGLRVVRPPFS 265 >gb|KVE34071.1| 11-S seed storage protein, plant, partial [Cynara cardunculus var. scolymus] Length = 196 Score = 66.6 bits (161), Expect = 2e-11 Identities = 29/50 (58%), Positives = 42/50 (84%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPPLT 90 NIF+GF+VE L++ F VD+ETA+ LQ + D+RGHI+ V++GLQVI PP++ Sbjct: 83 NIFQGFEVEILAKAFNVDRETAQMLQCQLDQRGHIVMVERGLQVIRPPMS 132 >gb|ABB77213.1| 11S globulin-like protein [Actinidia chinensis] Length = 462 Score = 67.8 bits (164), Expect = 3e-11 Identities = 29/50 (58%), Positives = 39/50 (78%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPPLT 90 N+FRGFD E L++ FGVD E AR LQG++D RGHII V++ L+++ PP T Sbjct: 215 NVFRGFDTEVLAETFGVDMEMARRLQGKDDYRGHIIQVERELKIVRPPRT 264 >gb|AGU36588.1| 11S globulin precursor, partial [Helianthus annuus] Length = 191 Score = 65.5 bits (158), Expect = 4e-11 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPP 96 NIF GF E ++Q F VDQETA+ LQG+ND+RGHI+ V + LQ++ PP Sbjct: 98 NIFNGFTPELIAQSFNVDQETAQKLQGQNDQRGHIVNVGQDLQIVRPP 145 >gb|AGU36580.1| 11S globulin precursor, partial [Helianthus annuus] Length = 191 Score = 65.5 bits (158), Expect = 4e-11 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = -1 Query: 239 NIFRGFDVETLSQVFGVDQETARSLQGENDERGHIITVQKGLQVITPP 96 NIF GF E ++Q F VDQETA+ LQG+ND+RGHI+ V + LQ++ PP Sbjct: 98 NIFNGFTPELIAQSFNVDQETAQKLQGQNDQRGHIVNVGQDLQIVRPP 145