BLASTX nr result
ID: Rehmannia28_contig00038542
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00038542 (432 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cyt... 99 2e-21 ref|XP_012848668.1| PREDICTED: aconitate hydratase, cytoplasmic ... 82 2e-15 emb|CDP05740.1| unnamed protein product [Coffea canephora] 76 2e-13 ref|XP_002524184.1| PREDICTED: aconitate hydratase, cytoplasmic ... 74 1e-12 ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic ... 73 2e-12 ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-... 71 8e-12 ref|XP_006376779.1| aconitate hydratase family protein [Populus ... 71 8e-12 gb|KDO62733.1| hypothetical protein CISIN_1g001863mg [Citrus sin... 70 1e-11 ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic ... 70 2e-11 ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citr... 70 2e-11 ref|XP_012089852.1| PREDICTED: aconitate hydratase, cytoplasmic ... 70 3e-11 gb|EPS60517.1| hypothetical protein M569_14286, partial [Genlise... 69 5e-11 ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic ... 69 7e-11 ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-... 69 7e-11 ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic ... 68 1e-10 ref|XP_007020811.1| Aconitase 3 [Theobroma cacao] gi|508720439|g... 67 2e-10 ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Popu... 66 6e-10 gb|KDO54661.1| hypothetical protein CISIN_1g001917mg [Citrus sin... 65 8e-10 ref|XP_006447556.1| hypothetical protein CICLE_v10014140mg [Citr... 65 8e-10 gb|KDO54659.1| hypothetical protein CISIN_1g001917mg [Citrus sin... 65 8e-10 >ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum indicum] Length = 1011 Score = 99.0 bits (245), Expect = 2e-21 Identities = 53/97 (54%), Positives = 58/97 (59%), Gaps = 1/97 (1%) Frame = +3 Query: 144 ILRACRVRFAXXXXXXXXXXXXXXXX-TFARNPPSHACXXXXXXXXXXXXXXXEFRLVRC 320 IL+ACRVRFA TFARNPP H+ R +RC Sbjct: 17 ILKACRVRFASTLSSSVKHSFSSPSSRTFARNPPLHSSSRPSSLGYRSLSFSSALRSIRC 76 Query: 321 SAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 SAPRWS+GVDWRSP SLRAQIRT SPVL+RFERKIAT Sbjct: 77 SAPRWSHGVDWRSPVSLRAQIRTASPVLERFERKIAT 113 >ref|XP_012848668.1| PREDICTED: aconitate hydratase, cytoplasmic [Erythranthe guttata] gi|604314633|gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata] Length = 1010 Score = 81.6 bits (200), Expect = 2e-15 Identities = 47/97 (48%), Positives = 53/97 (54%), Gaps = 1/97 (1%) Frame = +3 Query: 144 ILRACRVRFAXXXXXXXXXXXXXXXXTFARNPPSHACXXXXXXXXXXXXXXXEFRLVR-C 320 I RACRVRFA TFAR+ PS A R +R Sbjct: 16 IFRACRVRFASTLSPPVNHSFSSVSRTFARSSPSRAFTPPSNVSCRSLSFSSALRSIRYS 75 Query: 321 SAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 S+ RWS+G DWRSP SLRAQIR+ SPVL+RFERKIAT Sbjct: 76 SSQRWSHGADWRSPVSLRAQIRSSSPVLERFERKIAT 112 >emb|CDP05740.1| unnamed protein product [Coffea canephora] Length = 1009 Score = 75.9 bits (185), Expect = 2e-13 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +3 Query: 306 RLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 R +RCS PRWS+GVDWRSP SLRAQIRT +PV++RFERKIAT Sbjct: 72 RSLRCSVPRWSHGVDWRSPVSLRAQIRTAAPVIERFERKIAT 113 >ref|XP_002524184.1| PREDICTED: aconitate hydratase, cytoplasmic [Ricinus communis] gi|223536553|gb|EEF38199.1| aconitase, putative [Ricinus communis] Length = 997 Score = 73.6 bits (179), Expect = 1e-12 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 306 RLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 R +RCS PRWS+GVDWRSP SLR+QIRT SPV++RF+RKI+T Sbjct: 57 RSLRCSVPRWSHGVDWRSPVSLRSQIRTASPVIERFQRKIST 98 >ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica] gi|743907667|ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica] gi|743907669|ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica] Length = 1001 Score = 72.8 bits (177), Expect = 2e-12 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +3 Query: 303 FRLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 FR +RCS PRWS+GVDWRSPA+LR QIR VSP ++RF+RKIAT Sbjct: 61 FRSLRCSYPRWSHGVDWRSPATLRHQIRAVSPFVERFQRKIAT 103 >ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica] Length = 995 Score = 71.2 bits (173), Expect = 8e-12 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 306 RLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 R +RCS PRWS+GVDWRSPA+LR QIR V+PV++RF+RKIAT Sbjct: 56 RSLRCSYPRWSHGVDWRSPATLRHQIRAVAPVVERFQRKIAT 97 >ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa] gi|550326497|gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa] Length = 995 Score = 71.2 bits (173), Expect = 8e-12 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 306 RLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 R +RCS PRWS+GVDWRSPA+LR QIR V+PV++RF+RKIAT Sbjct: 56 RSLRCSYPRWSHGVDWRSPATLRHQIRAVAPVVERFQRKIAT 97 >gb|KDO62733.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis] Length = 875 Score = 70.5 bits (171), Expect = 1e-11 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +3 Query: 306 RLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 R VRCSAPRWS+GV+WRSP SLRAQ R +PVL+RF+RKIA+ Sbjct: 63 RTVRCSAPRWSHGVNWRSPVSLRAQSRIAAPVLERFQRKIAS 104 >ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera] Length = 992 Score = 70.5 bits (171), Expect = 2e-11 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 303 FRLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 FR +R S PRWS+G DWRSP SLRAQIRT +PV++RF+RKIAT Sbjct: 52 FRSLRSSPPRWSHGYDWRSPLSLRAQIRTAAPVIERFQRKIAT 94 >ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina] gi|568842252|ref|XP_006475065.1| PREDICTED: aconitate hydratase, cytoplasmic [Citrus sinensis] gi|557555603|gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina] gi|641843833|gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis] Length = 1002 Score = 70.5 bits (171), Expect = 2e-11 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +3 Query: 306 RLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 R VRCSAPRWS+GV+WRSP SLRAQ R +PVL+RF+RKIA+ Sbjct: 63 RTVRCSAPRWSHGVNWRSPVSLRAQSRIAAPVLERFQRKIAS 104 >ref|XP_012089852.1| PREDICTED: aconitate hydratase, cytoplasmic [Jatropha curcas] gi|643706801|gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas] Length = 998 Score = 69.7 bits (169), Expect = 3e-11 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = +3 Query: 306 RLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 R RCS PRWS+GVDWRSP SLR+QIR+ +PV+++F+RKIAT Sbjct: 59 RSFRCSVPRWSHGVDWRSPVSLRSQIRSAAPVIEQFQRKIAT 100 >gb|EPS60517.1| hypothetical protein M569_14286, partial [Genlisea aurea] Length = 862 Score = 68.9 bits (167), Expect = 5e-11 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +3 Query: 306 RLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 R +R SAPRWS+GVDWR P SLR+QI TVSPVL+RF RKIAT Sbjct: 26 RSLRISAPRWSHGVDWRYPVSLRSQIGTVSPVLERFHRKIAT 67 >ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis] Length = 996 Score = 68.6 bits (166), Expect = 7e-11 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +3 Query: 303 FRLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 FR +R S PRWS+GVDWRSPASLR QIR V+PV++R +RK AT Sbjct: 56 FRSLRSSVPRWSHGVDWRSPASLRPQIRAVAPVIERLQRKFAT 98 >ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera] Length = 997 Score = 68.6 bits (166), Expect = 7e-11 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = +3 Query: 303 FRLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 F +R SAPRWS+G DW+SP SLRAQIRT +PV++RF+RKIAT Sbjct: 57 FLSLRSSAPRWSHGFDWKSPLSLRAQIRTAAPVIERFQRKIAT 99 >ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris] Length = 996 Score = 67.8 bits (164), Expect = 1e-10 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +3 Query: 303 FRLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 FR VRCS PRWS+G+DW+SP SL AQIRT +P L+ F RK++T Sbjct: 56 FRSVRCSVPRWSHGIDWKSPISLTAQIRTAAPALNSFHRKLST 98 >ref|XP_007020811.1| Aconitase 3 [Theobroma cacao] gi|508720439|gb|EOY12336.1| Aconitase 3 [Theobroma cacao] Length = 951 Score = 67.4 bits (163), Expect = 2e-10 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +3 Query: 306 RLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 R +RCS+PRWS+GVDW SP SLRAQ+R PV++RF R+IAT Sbjct: 60 RSLRCSSPRWSHGVDWNSPGSLRAQVRIAVPVMERFRRRIAT 101 >ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa] gi|550324247|gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa] Length = 999 Score = 65.9 bits (159), Expect = 6e-10 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +3 Query: 306 RLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 R +RCS RWS+GVDWRSPA+LR QIR V+P ++RF+RKIAT Sbjct: 60 RSLRCSYRRWSHGVDWRSPATLRHQIRAVAPFVERFQRKIAT 101 >gb|KDO54661.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis] Length = 876 Score = 65.5 bits (158), Expect = 8e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +3 Query: 306 RLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 R RCS PRWS+ VDWRSP SLRAQIRTV+P ++R ER AT Sbjct: 57 RSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFAT 98 >ref|XP_006447556.1| hypothetical protein CICLE_v10014140mg [Citrus clementina] gi|557550167|gb|ESR60796.1| hypothetical protein CICLE_v10014140mg [Citrus clementina] Length = 888 Score = 65.5 bits (158), Expect = 8e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +3 Query: 306 RLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 R RCS PRWS+ VDWRSP SLRAQIRTV+P ++R ER AT Sbjct: 61 RSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFAT 102 >gb|KDO54659.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis] Length = 896 Score = 65.5 bits (158), Expect = 8e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +3 Query: 306 RLVRCSAPRWSYGVDWRSPASLRAQIRTVSPVLDRFERKIAT 431 R RCS PRWS+ VDWRSP SLRAQIRTV+P ++R ER AT Sbjct: 57 RSFRCSVPRWSHRVDWRSPLSLRAQIRTVAPAIERLERAFAT 98