BLASTX nr result
ID: Rehmannia28_contig00038329
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00038329 (408 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837199.1| PREDICTED: histone-lysine N-methyltransferas... 56 1e-06 >ref|XP_012837199.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-36 specific [Erythranthe guttata] gi|604333621|gb|EYU37972.1| hypothetical protein MIMGU_mgv1a005097mg [Erythranthe guttata] Length = 497 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/41 (60%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = -2 Query: 359 TADSRMNRGP-GVGNPGEGRYGIFNTDKSNVIPNKNENQRR 240 + D R++RGP GV N G+G++G+FN D SNVIPN NEN RR Sbjct: 457 STDPRVHRGPPGVDNSGQGKWGVFNRDNSNVIPNTNENHRR 497