BLASTX nr result
ID: Rehmannia28_contig00038280
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00038280 (328 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012844260.1| PREDICTED: uncharacterized protein LOC105964... 56 4e-07 >ref|XP_012844260.1| PREDICTED: uncharacterized protein LOC105964276 [Erythranthe guttata] Length = 385 Score = 56.2 bits (134), Expect = 4e-07 Identities = 26/44 (59%), Positives = 30/44 (68%) Frame = -3 Query: 134 MMLKTVFISCLWLAITSADILQNPDFELPPSNWNANSTSPFFTL 3 M L + C+ LA SA+IL N DFELPPSNW A+STSP F L Sbjct: 1 MKLPAILTLCILLATVSAEILLNADFELPPSNWKADSTSPLFPL 44