BLASTX nr result
ID: Rehmannia28_contig00038088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00038088 (551 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087639.1| PREDICTED: uncharacterized protein At5g08430... 74 3e-12 gb|EYU35021.1| hypothetical protein MIMGU_mgv1a021342mg, partial... 67 6e-10 ref|XP_012840239.1| PREDICTED: uncharacterized protein At5g08430... 67 7e-10 emb|CDO97639.1| unnamed protein product [Coffea canephora] 58 1e-06 >ref|XP_011087639.1| PREDICTED: uncharacterized protein At5g08430 [Sesamum indicum] Length = 780 Score = 73.9 bits (180), Expect = 3e-12 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +3 Query: 441 WHTCFRCRRSSHLHCYTCTKAACRRCLSAADILQVKG 551 WHTCF CRRSS+LHCYTC A CRRCL AAD LQVKG Sbjct: 64 WHTCFLCRRSSYLHCYTCKNAVCRRCLPAADFLQVKG 100 >gb|EYU35021.1| hypothetical protein MIMGU_mgv1a021342mg, partial [Erythranthe guttata] Length = 413 Score = 67.0 bits (162), Expect = 6e-10 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +3 Query: 438 DWHTCFRCRRSSHLHCYTCTKAACRRCLSAADILQVK 548 DWHTC+ CR+SS+ CYTCT A CRRCL +AD LQ+K Sbjct: 63 DWHTCYSCRKSSYFRCYTCTTAFCRRCLPSADFLQIK 99 >ref|XP_012840239.1| PREDICTED: uncharacterized protein At5g08430 [Erythranthe guttata] Length = 749 Score = 67.0 bits (162), Expect = 7e-10 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +3 Query: 438 DWHTCFRCRRSSHLHCYTCTKAACRRCLSAADILQVK 548 DWHTC+ CR+SS+ CYTCT A CRRCL +AD LQ+K Sbjct: 63 DWHTCYSCRKSSYFRCYTCTTAFCRRCLPSADFLQIK 99 >emb|CDO97639.1| unnamed protein product [Coffea canephora] Length = 644 Score = 57.8 bits (138), Expect = 1e-06 Identities = 20/38 (52%), Positives = 27/38 (71%) Frame = +3 Query: 438 DWHTCFRCRRSSHLHCYTCTKAACRRCLSAADILQVKG 551 +WH+CF C R +H HCY C A CR C+SAA+ +V+G Sbjct: 178 NWHSCFMCGRKAHFHCYCCPNALCRFCISAAEFCRVRG 215