BLASTX nr result
ID: Rehmannia28_contig00037416
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00037416 (376 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009800085.1| PREDICTED: uncharacterized protein LOC104246... 54 7e-06 >ref|XP_009800085.1| PREDICTED: uncharacterized protein LOC104246050 [Nicotiana sylvestris] Length = 690 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = -1 Query: 364 NSYFSGVIDDCKSLLKDMVQVSVCFVRRSANVVAHELARATCSMSGA 224 NSYF ++ DCK L++D +S+ FV+RSA AH LARA SMS A Sbjct: 622 NSYFDIIVQDCKELMRDFTSISLYFVKRSAKQRAHMLARAASSMSDA 668