BLASTX nr result
ID: Rehmannia28_contig00037196
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00037196 (693 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH26146.1| hypothetical protein GLYMA_12G154900 [Glycine max] 64 5e-10 >gb|KRH26146.1| hypothetical protein GLYMA_12G154900 [Glycine max] Length = 82 Score = 63.5 bits (153), Expect = 5e-10 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 693 SFTGFYLSFTGLFVPSYMMELPSANRHSTA 604 SFTGFYLSFTGLFVPS+MMELPSANRHSTA Sbjct: 50 SFTGFYLSFTGLFVPSFMMELPSANRHSTA 79