BLASTX nr result
ID: Rehmannia28_contig00037170
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00037170 (347 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012834286.1| PREDICTED: BTB/POZ domain-containing protein... 60 3e-08 ref|XP_011073542.1| PREDICTED: BTB/POZ domain-containing protein... 59 5e-08 ref|XP_011081133.1| PREDICTED: BTB/POZ domain-containing protein... 57 4e-07 ref|XP_010544783.1| PREDICTED: BTB/POZ domain-containing protein... 55 1e-06 ref|XP_006397812.1| hypothetical protein EUTSA_v10001385mg [Eutr... 55 2e-06 ref|XP_006397813.1| hypothetical protein EUTSA_v10001385mg [Eutr... 55 2e-06 ref|XP_015888842.1| PREDICTED: BTB/POZ domain-containing protein... 54 3e-06 ref|XP_008348526.1| PREDICTED: BTB/POZ domain-containing protein... 54 3e-06 dbj|BAO57282.1| POZ/BTB containing protein [Ipomoea nil] 54 4e-06 ref|XP_010506625.1| PREDICTED: BTB/POZ domain-containing protein... 54 5e-06 ref|XP_010506624.1| PREDICTED: BTB/POZ domain-containing protein... 54 5e-06 emb|CAB71090.1| putative protein [Arabidopsis thaliana] 53 9e-06 ref|XP_011023241.1| PREDICTED: BTB/POZ domain-containing protein... 53 9e-06 ref|XP_002301391.1| BTB/POZ domain-containing family protein [Po... 53 9e-06 ref|NP_850733.1| POZ/BTB containin G-protein 1 [Arabidopsis thal... 53 9e-06 ref|XP_006290834.1| hypothetical protein CARUB_v10016944mg [Caps... 53 9e-06 ref|XP_002876624.1| BTB/POZ domain-containing protein [Arabidops... 53 9e-06 ref|XP_010512512.1| PREDICTED: BTB/POZ domain-containing protein... 53 9e-06 ref|XP_010413379.1| PREDICTED: BTB/POZ domain-containing protein... 53 9e-06 >ref|XP_012834286.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Erythranthe guttata] gi|604336213|gb|EYU40044.1| hypothetical protein MIMGU_mgv1a004127mg [Erythranthe guttata] Length = 543 Score = 59.7 bits (143), Expect = 3e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIKK 266 WTAFIADDSPYFINGVLHLRAELTIKK Sbjct: 517 WTAFIADDSPYFINGVLHLRAELTIKK 543 >ref|XP_011073542.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Sesamum indicum] Length = 546 Score = 59.3 bits (142), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIKK 266 WTAFIADDSPYFING+LHLRAELTIKK Sbjct: 520 WTAFIADDSPYFINGILHLRAELTIKK 546 >ref|XP_011081133.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Sesamum indicum] Length = 435 Score = 56.6 bits (135), Expect = 4e-07 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIKK*TCLNDEKGECLGV 224 WTAF+AD SP+FING+LHLRAELTI+K + +D G LG+ Sbjct: 389 WTAFVADGSPFFINGILHLRAELTIEKESNEDDLYGGLLGI 429 >ref|XP_010544783.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Tarenaya hassleriana] Length = 558 Score = 55.5 bits (132), Expect = 1e-06 Identities = 23/27 (85%), Positives = 27/27 (100%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIKK 266 WT+FIA+DSPYFING+LHLRAELTIK+ Sbjct: 527 WTSFIAEDSPYFINGILHLRAELTIKR 553 >ref|XP_006397812.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum] gi|557098885|gb|ESQ39265.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum] Length = 530 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIKK*TCL 254 WT+FIADDS YFING+LHLRAELTIK+ T L Sbjct: 500 WTSFIADDSQYFINGILHLRAELTIKRSTDL 530 >ref|XP_006397813.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum] gi|557098886|gb|ESQ39266.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum] Length = 554 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIKK*TCL 254 WT+FIADDS YFING+LHLRAELTIK+ T L Sbjct: 524 WTSFIADDSQYFINGILHLRAELTIKRSTDL 554 >ref|XP_015888842.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Ziziphus jujuba] Length = 551 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIK 269 WT+F+ADDSPYFINGVLHLRAELTI+ Sbjct: 525 WTSFMADDSPYFINGVLHLRAELTIR 550 >ref|XP_008348526.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Malus domestica] Length = 556 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/27 (85%), Positives = 27/27 (100%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIKK 266 WT+F+ADDSP+FINGVLHLRAELTIK+ Sbjct: 530 WTSFMADDSPFFINGVLHLRAELTIKQ 556 >dbj|BAO57282.1| POZ/BTB containing protein [Ipomoea nil] Length = 549 Score = 53.9 bits (128), Expect = 4e-06 Identities = 22/26 (84%), Positives = 26/26 (100%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIK 269 WT+F+ADDSPYFING+LHLRAELTI+ Sbjct: 523 WTSFMADDSPYFINGILHLRAELTIR 548 >ref|XP_010506625.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like isoform X2 [Camelina sativa] Length = 559 Score = 53.5 bits (127), Expect = 5e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIKK*TCLN 251 WT+F+A+DSP+FING+LHLRAELTIK+ T L+ Sbjct: 528 WTSFMAEDSPHFINGILHLRAELTIKRSTDLH 559 >ref|XP_010506624.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like isoform X1 [Camelina sativa] Length = 563 Score = 53.5 bits (127), Expect = 5e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIKK*TCLN 251 WT+F+A+DSP+FING+LHLRAELTIK+ T L+ Sbjct: 532 WTSFMAEDSPHFINGILHLRAELTIKRSTDLH 563 >emb|CAB71090.1| putative protein [Arabidopsis thaliana] Length = 545 Score = 52.8 bits (125), Expect = 9e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIKK*T 260 WT+FIA+DS YFING+LHLRAELTIK+ T Sbjct: 515 WTSFIAEDSQYFINGILHLRAELTIKRST 543 >ref|XP_011023241.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Populus euphratica] Length = 553 Score = 52.8 bits (125), Expect = 9e-06 Identities = 22/26 (84%), Positives = 26/26 (100%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIK 269 WT+F+A+DSPYFINGVLHLRAELTI+ Sbjct: 527 WTSFMAEDSPYFINGVLHLRAELTIR 552 >ref|XP_002301391.1| BTB/POZ domain-containing family protein [Populus trichocarpa] gi|222843117|gb|EEE80664.1| BTB/POZ domain-containing family protein [Populus trichocarpa] Length = 556 Score = 52.8 bits (125), Expect = 9e-06 Identities = 22/26 (84%), Positives = 26/26 (100%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIK 269 WT+F+A+DSPYFINGVLHLRAELTI+ Sbjct: 530 WTSFMAEDSPYFINGVLHLRAELTIR 555 >ref|NP_850733.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana] gi|327488374|sp|Q9FPW6.2|POB1_ARATH RecName: Full=BTB/POZ domain-containing protein POB1; AltName: Full=POZ/BTB CONTAINING-PROTEIN 1; Short=AtPOB1 gi|332646708|gb|AEE80229.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana] Length = 561 Score = 52.8 bits (125), Expect = 9e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIKK*T 260 WT+FIA+DS YFING+LHLRAELTIK+ T Sbjct: 531 WTSFIAEDSQYFINGILHLRAELTIKRST 559 >ref|XP_006290834.1| hypothetical protein CARUB_v10016944mg [Capsella rubella] gi|482559541|gb|EOA23732.1| hypothetical protein CARUB_v10016944mg [Capsella rubella] Length = 562 Score = 52.8 bits (125), Expect = 9e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIKK*T 260 WT+FIA+DS YFING+LHLRAELTIK+ T Sbjct: 532 WTSFIAEDSQYFINGILHLRAELTIKRST 560 >ref|XP_002876624.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322462|gb|EFH52883.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 562 Score = 52.8 bits (125), Expect = 9e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIKK*T 260 WT+FIA+DS YFING+LHLRAELTIK+ T Sbjct: 532 WTSFIAEDSQYFINGILHLRAELTIKRST 560 >ref|XP_010512512.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Camelina sativa] Length = 568 Score = 52.8 bits (125), Expect = 9e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIKK*T 260 WT+FIA+DS YFING+LHLRAELTIK+ T Sbjct: 538 WTSFIAEDSQYFINGILHLRAELTIKRST 566 >ref|XP_010413379.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Camelina sativa] Length = 570 Score = 52.8 bits (125), Expect = 9e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -2 Query: 346 WTAFIADDSPYFINGVLHLRAELTIKK*T 260 WT+FIA+DS YFING+LHLRAELTIK+ T Sbjct: 540 WTSFIAEDSQYFINGILHLRAELTIKRST 568