BLASTX nr result
ID: Rehmannia28_contig00036977
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00036977 (301 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP56414.1| Putative disease resistance protein RGA3 [Cajanus... 65 3e-10 ref|XP_012853073.1| PREDICTED: putative disease resistance prote... 64 9e-10 ref|XP_012854110.1| PREDICTED: putative disease resistance prote... 63 1e-09 gb|EYU23335.1| hypothetical protein MIMGU_mgv1a018297mg [Erythra... 63 1e-09 ref|XP_006573177.1| PREDICTED: disease resistance protein RGA2-l... 63 2e-09 ref|XP_007157499.1| hypothetical protein PHAVU_002G074700g [Phas... 62 2e-09 ref|XP_012853072.1| PREDICTED: putative disease resistance prote... 62 3e-09 gb|EYU24299.1| hypothetical protein MIMGU_mgv1a0242341mg, partia... 62 3e-09 gb|EYU23272.1| hypothetical protein MIMGU_mgv1a024450mg [Erythra... 62 3e-09 ref|XP_014627470.1| PREDICTED: LOW QUALITY PROTEIN: putative dis... 62 3e-09 gb|KYP65543.1| Putative disease resistance protein RGA3 [Cajanus... 62 3e-09 gb|KYP41900.1| Putative disease resistance protein RGA3 [Cajanus... 62 3e-09 gb|EYU43095.1| hypothetical protein MIMGU_mgv1a022079mg [Erythra... 62 3e-09 ref|XP_012830413.1| PREDICTED: putative disease resistance prote... 62 3e-09 gb|KHN45293.1| Disease resistance protein RGA2 [Glycine soja] 62 4e-09 ref|XP_006573066.2| PREDICTED: putative disease resistance prote... 62 4e-09 ref|XP_014619948.1| PREDICTED: putative disease resistance prote... 62 4e-09 gb|EYU28987.1| hypothetical protein MIMGU_mgv1a0225243mg, partia... 61 6e-09 ref|XP_012847400.1| PREDICTED: putative disease resistance prote... 61 6e-09 gb|EYU23294.1| hypothetical protein MIMGU_mgv1a021675mg, partial... 61 6e-09 >gb|KYP56414.1| Putative disease resistance protein RGA3 [Cajanus cajan] Length = 1095 Score = 65.1 bits (157), Expect = 3e-10 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 +G++KHLRYL+LC ++P SLCNLWN+QILKLDYC+ L Sbjct: 530 IGHLKHLRYLSLCFSYFTSLPESLCNLWNIQILKLDYCQRL 570 >ref|XP_012853073.1| PREDICTED: putative disease resistance protein RGA4 [Erythranthe guttata] Length = 1075 Score = 63.5 bits (153), Expect = 9e-10 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 VGN+KHLR LNL EIR +P+S+C+LWNLQ+L LDYC L Sbjct: 562 VGNLKHLRQLNLSGAEIRTLPDSICSLWNLQVLNLDYCRGL 602 >ref|XP_012854110.1| PREDICTED: putative disease resistance protein RGA4 [Erythranthe guttata] Length = 580 Score = 63.2 bits (152), Expect = 1e-09 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 VGN+KHLR+LNL EIR++P+SLC+LWNL +L LD CE+L Sbjct: 65 VGNLKHLRHLNLSGTEIRSLPDSLCSLWNLHVLNLDDCEKL 105 >gb|EYU23335.1| hypothetical protein MIMGU_mgv1a018297mg [Erythranthe guttata] Length = 1053 Score = 63.2 bits (152), Expect = 1e-09 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 VGN+KHLR+LNL EIR++P+SLC+LWNL +L LD CE+L Sbjct: 562 VGNLKHLRHLNLSGTEIRSLPDSLCSLWNLHVLNLDDCEKL 602 >ref|XP_006573177.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] gi|571434367|ref|XP_006573178.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] gi|571434369|ref|XP_006573179.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] gi|955302218|ref|XP_014629263.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] gi|955302220|ref|XP_014629265.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] gi|955302222|ref|XP_014629267.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] gi|955302226|ref|XP_014629273.1| PREDICTED: disease resistance protein RGA2-like [Glycine max] gi|947127300|gb|KRH75154.1| hypothetical protein GLYMA_01G065800 [Glycine max] Length = 886 Score = 62.8 bits (151), Expect = 2e-09 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYC 42 +G++KHLRYLNL R + +P SLC LWNLQILKLDYC Sbjct: 593 IGHLKHLRYLNLSRGGFKTLPESLCKLWNLQILKLDYC 630 >ref|XP_007157499.1| hypothetical protein PHAVU_002G074700g [Phaseolus vulgaris] gi|561030914|gb|ESW29493.1| hypothetical protein PHAVU_002G074700g [Phaseolus vulgaris] Length = 619 Score = 62.4 bits (150), Expect = 2e-09 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 +G++KHLRY+NL + + + +P LC LWNLQILKLDYC+ L Sbjct: 339 IGDLKHLRYMNLSKSDFKTLPEFLCKLWNLQILKLDYCKHL 379 >ref|XP_012853072.1| PREDICTED: putative disease resistance protein RGA3 [Erythranthe guttata] Length = 679 Score = 62.0 bits (149), Expect = 3e-09 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 VGN+KHLR LNL +IR +P+SLC LWNLQ+L LD CE+L Sbjct: 540 VGNLKHLRQLNLSGTQIRTLPDSLCRLWNLQVLNLDDCEKL 580 >gb|EYU24299.1| hypothetical protein MIMGU_mgv1a0242341mg, partial [Erythranthe guttata] Length = 685 Score = 62.0 bits (149), Expect = 3e-09 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 VGN+KHLR LNL +IR +P+SLC LWNLQ+L LD CE+L Sbjct: 547 VGNLKHLRQLNLSGTQIRTLPDSLCRLWNLQVLNLDDCEKL 587 >gb|EYU23272.1| hypothetical protein MIMGU_mgv1a024450mg [Erythranthe guttata] Length = 854 Score = 62.0 bits (149), Expect = 3e-09 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 VGN+KHLR LNL +IR +P+SLC LWNLQ+L LD CE+L Sbjct: 450 VGNLKHLRQLNLSGTQIRTLPDSLCRLWNLQVLNLDDCEKL 490 >ref|XP_014627470.1| PREDICTED: LOW QUALITY PROTEIN: putative disease resistance protein RGA4 [Glycine max] Length = 897 Score = 62.0 bits (149), Expect = 3e-09 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 +G++KHL+YLNL + + +P SLC LWNLQILKLD+CE L Sbjct: 581 IGHLKHLKYLNLSGGDFKTLPESLCKLWNLQILKLDHCERL 621 >gb|KYP65543.1| Putative disease resistance protein RGA3 [Cajanus cajan] Length = 1011 Score = 62.0 bits (149), Expect = 3e-09 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 +GN+KHLRYLNL + +P SLC LWNLQILKLD C L Sbjct: 503 IGNLKHLRYLNLSNGSFKTLPKSLCKLWNLQILKLDQCNNL 543 >gb|KYP41900.1| Putative disease resistance protein RGA3 [Cajanus cajan] Length = 1026 Score = 62.0 bits (149), Expect = 3e-09 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 +GN+KHLRYLNL + + +P SLC LWNLQILKLD C +L Sbjct: 567 IGNLKHLRYLNLSYGKFKTLPESLCELWNLQILKLDRCNDL 607 >gb|EYU43095.1| hypothetical protein MIMGU_mgv1a022079mg [Erythranthe guttata] Length = 1034 Score = 62.0 bits (149), Expect = 3e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 VGN+KHLR LNL EIR +P+S+C+LWNLQIL L+ CE+L Sbjct: 561 VGNLKHLRQLNLSATEIRTLPDSICSLWNLQILNLNACEKL 601 >ref|XP_012830413.1| PREDICTED: putative disease resistance protein RGA4 [Erythranthe guttata] Length = 1064 Score = 62.0 bits (149), Expect = 3e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 VGN+KHLR LNL EIR +P+S+C+LWNLQIL L+ CE+L Sbjct: 561 VGNLKHLRQLNLSATEIRTLPDSICSLWNLQILNLNACEKL 601 >gb|KHN45293.1| Disease resistance protein RGA2 [Glycine soja] Length = 831 Score = 61.6 bits (148), Expect = 4e-09 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 +G++KHLRYLNL E +P SLC LWNLQILKLD+C L Sbjct: 534 IGDLKHLRYLNLSGGEFETLPESLCKLWNLQILKLDHCRSL 574 >ref|XP_006573066.2| PREDICTED: putative disease resistance protein RGA3 [Glycine max] gi|947126819|gb|KRH74673.1| hypothetical protein GLYMA_01G035400 [Glycine max] Length = 870 Score = 61.6 bits (148), Expect = 4e-09 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 +G++KHLRYLNL E +P SLC LWNLQILKLD+C L Sbjct: 564 IGDLKHLRYLNLSGGEFETLPESLCKLWNLQILKLDHCRSL 604 >ref|XP_014619948.1| PREDICTED: putative disease resistance protein RGA3 [Glycine max] gi|947121220|gb|KRH69426.1| hypothetical protein GLYMA_02G026200 [Glycine max] Length = 884 Score = 61.6 bits (148), Expect = 4e-09 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 +G++KHLRYLNLC +P SLC LWNLQILKLD+C L Sbjct: 581 IGDLKHLRYLNLCGGHFVTLPESLCRLWNLQILKLDHCYHL 621 >gb|EYU28987.1| hypothetical protein MIMGU_mgv1a0225243mg, partial [Erythranthe guttata] Length = 671 Score = 61.2 bits (147), Expect = 6e-09 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 VGN+KHLR+LNL EIR++P+SLC+LWNL +L LD C +L Sbjct: 336 VGNLKHLRHLNLSGSEIRSLPDSLCSLWNLHVLNLDGCRKL 376 >ref|XP_012847400.1| PREDICTED: putative disease resistance protein RGA3, partial [Erythranthe guttata] Length = 672 Score = 61.2 bits (147), Expect = 6e-09 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 VGN+KHLR+LNL EIR++P+SLC+LWNL +L LD C +L Sbjct: 331 VGNLKHLRHLNLSGSEIRSLPDSLCSLWNLHVLNLDGCRKL 371 >gb|EYU23294.1| hypothetical protein MIMGU_mgv1a021675mg, partial [Erythranthe guttata] Length = 838 Score = 61.2 bits (147), Expect = 6e-09 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -3 Query: 155 VGNVKHLRYLNLCRPEIRNIPNSLCNLWNLQILKLDYCEEL 33 VGN+KHLR+LNL EIR +P+SLC LWNL +L LD C++L Sbjct: 367 VGNLKHLRHLNLSGTEIRTLPDSLCGLWNLHVLNLDECKKL 407