BLASTX nr result
ID: Rehmannia28_contig00036863
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00036863 (379 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847569.1| PREDICTED: probable inactive purple acid pho... 76 8e-14 ref|XP_011075578.1| PREDICTED: probable inactive purple acid pho... 73 9e-13 emb|CDP00410.1| unnamed protein product [Coffea canephora] 66 2e-10 emb|CAN70143.1| hypothetical protein VITISV_032086 [Vitis vinifera] 65 6e-10 ref|XP_002274401.1| PREDICTED: probable inactive purple acid pho... 65 6e-10 ref|XP_008389413.1| PREDICTED: probable inactive purple acid pho... 62 6e-09 ref|XP_010259195.1| PREDICTED: probable inactive purple acid pho... 62 8e-09 ref|XP_011012307.1| PREDICTED: probable inactive purple acid pho... 61 2e-08 ref|XP_009356377.1| PREDICTED: probable inactive purple acid pho... 60 4e-08 gb|EPS65927.1| hypothetical protein M569_08847, partial [Genlise... 59 9e-08 ref|XP_010258128.1| PREDICTED: probable inactive purple acid pho... 59 9e-08 ref|XP_009590899.1| PREDICTED: probable inactive purple acid pho... 59 1e-07 ref|XP_010096580.1| putative inactive purple acid phosphatase 2 ... 59 1e-07 ref|XP_010107457.1| putative inactive purple acid phosphatase 2 ... 59 1e-07 ref|XP_004505373.1| PREDICTED: probable inactive purple acid pho... 58 2e-07 ref|XP_002316099.2| purple acid phosphatase family protein [Popu... 58 2e-07 ref|XP_009804691.1| PREDICTED: probable inactive purple acid pho... 57 3e-07 ref|XP_008465701.1| PREDICTED: probable inactive purple acid pho... 57 3e-07 ref|XP_004143791.1| PREDICTED: probable inactive purple acid pho... 57 3e-07 ref|XP_010923588.1| PREDICTED: probable inactive purple acid pho... 57 4e-07 >ref|XP_012847569.1| PREDICTED: probable inactive purple acid phosphatase 9 [Erythranthe guttata] gi|604316648|gb|EYU28840.1| hypothetical protein MIMGU_mgv1a002643mg [Erythranthe guttata] Length = 651 Score = 76.3 bits (186), Expect = 8e-14 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -2 Query: 378 LSWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEE 247 +SWYVKVASILVLGAFLGYV+GFVSRSRRD A +WTAVKSE+ Sbjct: 607 ISWYVKVASILVLGAFLGYVVGFVSRSRRDAASEAKWTAVKSED 650 >ref|XP_011075578.1| PREDICTED: probable inactive purple acid phosphatase 2 [Sesamum indicum] Length = 660 Score = 73.2 bits (178), Expect = 9e-13 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -2 Query: 378 LSWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEET 244 LSWYV +ASILVLGAF+GYVLGF+SRSRR A +WTAVKS+ET Sbjct: 616 LSWYVMLASILVLGAFIGYVLGFISRSRRSAATEAQWTAVKSDET 660 >emb|CDP00410.1| unnamed protein product [Coffea canephora] Length = 494 Score = 66.2 bits (160), Expect = 2e-10 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -2 Query: 375 SWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEE 247 SWYVKV S+L+LGAF+GYV GFVS RRD A G WT VK+EE Sbjct: 451 SWYVKVGSLLLLGAFIGYVFGFVSHYRRDTASGANWTPVKNEE 493 >emb|CAN70143.1| hypothetical protein VITISV_032086 [Vitis vinifera] Length = 632 Score = 65.1 bits (157), Expect = 6e-10 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -2 Query: 375 SWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEET 244 SWYVK ASILVLGAF+GYV+GFVS +RR+ AL WT VK E++ Sbjct: 589 SWYVKGASILVLGAFMGYVIGFVSHARREAALRKNWTPVKIEDS 632 >ref|XP_002274401.1| PREDICTED: probable inactive purple acid phosphatase 2 [Vitis vinifera] Length = 652 Score = 65.1 bits (157), Expect = 6e-10 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -2 Query: 375 SWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEET 244 SWYVK ASILVLGAF+GYV+GFVS +RR+ AL WT VK E++ Sbjct: 609 SWYVKGASILVLGAFMGYVIGFVSHARREAALRKNWTPVKIEDS 652 >ref|XP_008389413.1| PREDICTED: probable inactive purple acid phosphatase 2 [Malus domestica] Length = 657 Score = 62.4 bits (150), Expect = 6e-09 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -2 Query: 375 SWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEET 244 SW+VK AS+LVLG F+GYV+G++S SR+ G+ WT VKSEET Sbjct: 614 SWFVKGASVLVLGVFIGYVVGYISYSRKKAVPGSNWTPVKSEET 657 >ref|XP_010259195.1| PREDICTED: probable inactive purple acid phosphatase 2 [Nelumbo nucifera] Length = 652 Score = 62.0 bits (149), Expect = 8e-09 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -2 Query: 378 LSWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEE 247 LSW+VK SILVLGAFLGYV+GFVS +R++ WTAVK+E+ Sbjct: 608 LSWFVKGGSILVLGAFLGYVIGFVSHARKESIFKRSWTAVKTED 651 >ref|XP_011012307.1| PREDICTED: probable inactive purple acid phosphatase 2 [Populus euphratica] Length = 386 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -2 Query: 375 SWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEET 244 SWYVK AS+LVLGAF+GY+LG+ S SR+ WT VKSE+T Sbjct: 343 SWYVKGASVLVLGAFVGYILGYASHSRKQNGNKASWTPVKSEDT 386 >ref|XP_009356377.1| PREDICTED: probable inactive purple acid phosphatase 2 [Pyrus x bretschneideri] Length = 657 Score = 60.1 bits (144), Expect = 4e-08 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -2 Query: 375 SWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEET 244 SW+VK AS+LVLG F+GYV+G++S SR+ G+ W VKSEET Sbjct: 614 SWFVKGASVLVLGVFIGYVVGYISYSRKKAVPGSNWIPVKSEET 657 >gb|EPS65927.1| hypothetical protein M569_08847, partial [Genlisea aurea] Length = 615 Score = 58.9 bits (141), Expect = 9e-08 Identities = 25/41 (60%), Positives = 36/41 (87%) Frame = -2 Query: 372 WYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSE 250 WYVK+ S++VLG FLGYV+GF++R+RR+ A T+WTAVK++ Sbjct: 576 WYVKMGSVVVLGGFLGYVMGFLTRNRREDA-ATKWTAVKTD 615 >ref|XP_010258128.1| PREDICTED: probable inactive purple acid phosphatase 2 [Nelumbo nucifera] Length = 652 Score = 58.9 bits (141), Expect = 9e-08 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -2 Query: 378 LSWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEE 247 LSW VK SILVLGAFLGYV G++S +RR+ WTAVK+EE Sbjct: 608 LSWLVKGGSILVLGAFLGYVTGYISHARRESISRRGWTAVKTEE 651 >ref|XP_009590899.1| PREDICTED: probable inactive purple acid phosphatase 2 [Nicotiana tomentosiformis] Length = 653 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = -2 Query: 375 SWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEE 247 SW+VKV S+LVLGAF+GY++GF+S +R++ A G W VKSEE Sbjct: 611 SWFVKVGSVLVLGAFMGYIVGFISHARKNAA-GEGWRPVKSEE 652 >ref|XP_010096580.1| putative inactive purple acid phosphatase 2 [Morus notabilis] gi|587875983|gb|EXB65080.1| putative inactive purple acid phosphatase 2 [Morus notabilis] Length = 665 Score = 58.5 bits (140), Expect = 1e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -2 Query: 375 SWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEET 244 S++VK ASILVLGAF+GYVLGF+S +R+ WT VKSEET Sbjct: 622 SFFVKGASILVLGAFIGYVLGFISHARKGALPRNNWTPVKSEET 665 >ref|XP_010107457.1| putative inactive purple acid phosphatase 2 [Morus notabilis] gi|587969374|gb|EXC54351.1| putative inactive purple acid phosphatase 2 [Morus notabilis] Length = 692 Score = 58.5 bits (140), Expect = 1e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -2 Query: 375 SWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEET 244 S++VK ASILVLGAF+GYVLGF+S +R+ WT VKSEET Sbjct: 649 SFFVKGASILVLGAFIGYVLGFISHARKGALPRNNWTPVKSEET 692 >ref|XP_004505373.1| PREDICTED: probable inactive purple acid phosphatase 2 [Cicer arietinum] Length = 657 Score = 58.2 bits (139), Expect = 2e-07 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -2 Query: 378 LSWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEET 244 LSWYV+ S+LVLGAF+GY+LGF+SR+R+ + +T VK+EET Sbjct: 613 LSWYVQGGSVLVLGAFMGYILGFISRARKQPESRSGFTPVKTEET 657 >ref|XP_002316099.2| purple acid phosphatase family protein [Populus trichocarpa] gi|550329971|gb|EEF02270.2| purple acid phosphatase family protein [Populus trichocarpa] Length = 647 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = -2 Query: 375 SWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEE 247 SWYVK AS+LVLGAF+GY LG+ S SR+ WT VKSE+ Sbjct: 604 SWYVKGASVLVLGAFVGYTLGYASHSRKQNGNKASWTPVKSED 646 >ref|XP_009804691.1| PREDICTED: probable inactive purple acid phosphatase 2 [Nicotiana sylvestris] Length = 652 Score = 57.4 bits (137), Expect = 3e-07 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = -2 Query: 375 SWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEE 247 SW+VKV S+LVLGAF+GY++GF+S +R++ A G W VK+EE Sbjct: 610 SWFVKVGSVLVLGAFMGYIVGFISHARKNAA-GEGWRPVKTEE 651 >ref|XP_008465701.1| PREDICTED: probable inactive purple acid phosphatase 2 [Cucumis melo] Length = 660 Score = 57.4 bits (137), Expect = 3e-07 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -2 Query: 375 SWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEE 247 SWYV SILVLGAF+GY++GFVS +R++ WT VK+EE Sbjct: 616 SWYVMGGSILVLGAFIGYIIGFVSHARKNSISRNNWTPVKTEE 658 >ref|XP_004143791.1| PREDICTED: probable inactive purple acid phosphatase 2 [Cucumis sativus] gi|700196018|gb|KGN51195.1| hypothetical protein Csa_5G487720 [Cucumis sativus] Length = 660 Score = 57.4 bits (137), Expect = 3e-07 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -2 Query: 375 SWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEE 247 SWYV SILVLGAF+GY++GFVS +R++ WT VK+EE Sbjct: 616 SWYVMGGSILVLGAFIGYIIGFVSHARKNSLSRNNWTPVKTEE 658 >ref|XP_010923588.1| PREDICTED: probable inactive purple acid phosphatase 2 isoform X2 [Elaeis guineensis] Length = 595 Score = 57.0 bits (136), Expect = 4e-07 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -2 Query: 378 LSWYVKVASILVLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEET 244 L WYV+ A +L+LG F+GY LG+++R RRD WT VKSEET Sbjct: 551 LLWYVEGAIVLMLGVFMGYALGYLTRCRRDAVQRATWTPVKSEET 595