BLASTX nr result
ID: Rehmannia28_contig00036843
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00036843 (375 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44501.1| hypothetical protein MIMGU_mgv1a002053mg [Erythra... 62 7e-09 gb|EYU44500.1| hypothetical protein MIMGU_mgv1a002053mg [Erythra... 62 7e-09 ref|XP_012854009.1| PREDICTED: pentatricopeptide repeat-containi... 62 7e-09 ref|XP_011099383.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-08 ref|XP_015066437.1| PREDICTED: pentatricopeptide repeat-containi... 54 4e-06 ref|XP_010316025.1| PREDICTED: pentatricopeptide repeat-containi... 54 4e-06 >gb|EYU44501.1| hypothetical protein MIMGU_mgv1a002053mg [Erythranthe guttata] Length = 685 Score = 62.0 bits (149), Expect = 7e-09 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = +3 Query: 231 NRRLAKQTSKLPPPLTDTQQQAILEESHFQTIKSVTINR--RYEENEKLV 374 NRRLAKQTSKLPPPL+D Q++A+LEESHF+TIK N+ + E EKLV Sbjct: 51 NRRLAKQTSKLPPPLSDAQREAVLEESHFRTIKK-EYNKFTKNEATEKLV 99 >gb|EYU44500.1| hypothetical protein MIMGU_mgv1a002053mg [Erythranthe guttata] Length = 721 Score = 62.0 bits (149), Expect = 7e-09 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = +3 Query: 231 NRRLAKQTSKLPPPLTDTQQQAILEESHFQTIKSVTINR--RYEENEKLV 374 NRRLAKQTSKLPPPL+D Q++A+LEESHF+TIK N+ + E EKLV Sbjct: 51 NRRLAKQTSKLPPPLSDAQREAVLEESHFRTIKK-EYNKFTKNEATEKLV 99 >ref|XP_012854009.1| PREDICTED: pentatricopeptide repeat-containing protein At5g67570, chloroplastic [Erythranthe guttata] Length = 785 Score = 62.0 bits (149), Expect = 7e-09 Identities = 33/50 (66%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = +3 Query: 231 NRRLAKQTSKLPPPLTDTQQQAILEESHFQTIKSVTINR--RYEENEKLV 374 NRRLAKQTSKLPPPL+D Q++A+LEESHF+TIK N+ + E EKLV Sbjct: 51 NRRLAKQTSKLPPPLSDAQREAVLEESHFRTIKK-EYNKFTKNEATEKLV 99 >ref|XP_011099383.1| PREDICTED: pentatricopeptide repeat-containing protein At5g67570, chloroplastic [Sesamum indicum] Length = 868 Score = 61.2 bits (147), Expect = 1e-08 Identities = 34/52 (65%), Positives = 38/52 (73%), Gaps = 4/52 (7%) Frame = +3 Query: 231 NRRLAKQTSKLPPPLTDTQQQAILEESHFQTIKS----VTINRRYEENEKLV 374 NRRLAK SKLPPPLTD Q+Q+I EESHF IKS T + R EEN+KLV Sbjct: 47 NRRLAKLNSKLPPPLTDAQKQSISEESHFHMIKSDYKKFTKSVRNEENKKLV 98 >ref|XP_015066437.1| PREDICTED: pentatricopeptide repeat-containing protein At5g67570, chloroplastic [Solanum pennellii] Length = 871 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +3 Query: 231 NRRLAKQTSKLPPPLTDTQQQAILEESHFQTIKS 332 NRRLAK+ +K PPPLTDTQ+QA+ EES+FQ +KS Sbjct: 50 NRRLAKKAAKEPPPLTDTQKQALAEESYFQAVKS 83 >ref|XP_010316025.1| PREDICTED: pentatricopeptide repeat-containing protein At5g67570, chloroplastic [Solanum lycopersicum] Length = 871 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = +3 Query: 231 NRRLAKQTSKLPPPLTDTQQQAILEESHFQTIKS 332 NRRLAK+ +K PPPLTDTQ+QA+ EES+FQ +KS Sbjct: 50 NRRLAKKAAKEPPPLTDTQKQALAEESYFQAVKS 83