BLASTX nr result
ID: Rehmannia28_contig00036793
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00036793 (510 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011069542.1| PREDICTED: sister chromatid cohesion protein... 84 5e-16 gb|EYU22962.1| hypothetical protein MIMGU_mgv1a022714mg, partial... 77 2e-15 ref|XP_012854886.1| PREDICTED: sister chromatid cohesion protein... 77 2e-13 >ref|XP_011069542.1| PREDICTED: sister chromatid cohesion protein PDS5 homolog A [Sesamum indicum] Length = 1387 Score = 84.3 bits (207), Expect = 5e-16 Identities = 44/70 (62%), Positives = 52/70 (74%) Frame = -1 Query: 510 DMDDLQARYCNHSGETSANDQANILDANGYDSKQENLLKERDNCIRKVSQPVKRVKRRED 331 D+DDLQ +YC+ S ++SANDQ +DA+ YDSKQENL K D RKVSQ VKR KR +D Sbjct: 1300 DLDDLQVQYCSQSHDSSANDQTKAVDAHRYDSKQENLPKNGDIRGRKVSQAVKRTKRCKD 1359 Query: 330 AIGTSTSEVI 301 A G STSEVI Sbjct: 1360 ASGKSTSEVI 1369 >gb|EYU22962.1| hypothetical protein MIMGU_mgv1a022714mg, partial [Erythranthe guttata] Length = 116 Score = 77.0 bits (188), Expect = 2e-15 Identities = 42/72 (58%), Positives = 55/72 (76%), Gaps = 2/72 (2%) Frame = -1 Query: 510 DMDDLQARYCNHSGETSANDQANILDANGYDSKQENLLKERDNCIRKV-SQPVKRVKRRE 334 D+DDLQA+ C++ G +SAND+ +LDA G+DS QENL ++R+ +RK SQ VKR KR E Sbjct: 43 DLDDLQAQRCDYGGGSSANDEDKLLDAQGFDSIQENLPRKRNKSVRKASSQAVKRSKRCE 102 Query: 333 D-AIGTSTSEVI 301 D AIG+ TSEVI Sbjct: 103 DAAIGSLTSEVI 114 >ref|XP_012854886.1| PREDICTED: sister chromatid cohesion protein PDS5 homolog A [Erythranthe guttata] Length = 1353 Score = 77.0 bits (188), Expect = 2e-13 Identities = 42/72 (58%), Positives = 55/72 (76%), Gaps = 2/72 (2%) Frame = -1 Query: 510 DMDDLQARYCNHSGETSANDQANILDANGYDSKQENLLKERDNCIRKV-SQPVKRVKRRE 334 D+DDLQA+ C++ G +SAND+ +LDA G+DS QENL ++R+ +RK SQ VKR KR E Sbjct: 1280 DLDDLQAQRCDYGGGSSANDEDKLLDAQGFDSIQENLPRKRNKSVRKASSQAVKRSKRCE 1339 Query: 333 D-AIGTSTSEVI 301 D AIG+ TSEVI Sbjct: 1340 DAAIGSLTSEVI 1351