BLASTX nr result
ID: Rehmannia28_contig00035766
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00035766 (401 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012857881.1| PREDICTED: pentatricopeptide repeat-containi... 69 4e-11 ref|XP_011087498.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-10 ref|XP_010101867.1| hypothetical protein L484_023657 [Morus nota... 64 1e-09 ref|XP_015874902.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-08 ref|XP_010546764.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-08 ref|XP_015384117.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-07 gb|KDO81649.1| hypothetical protein CISIN_1g006246mg [Citrus sin... 59 2e-07 emb|CDP15243.1| unnamed protein product [Coffea canephora] 59 2e-07 ref|XP_011038940.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-07 ref|XP_007207048.1| hypothetical protein PRUPE_ppb025182mg [Prun... 56 1e-06 ref|XP_004304899.1| PREDICTED: pentatricopeptide repeat-containi... 55 2e-06 emb|CBI39605.3| unnamed protein product [Vitis vinifera] 55 3e-06 ref|XP_002281942.1| PREDICTED: pentatricopeptide repeat-containi... 55 3e-06 ref|XP_008246072.1| PREDICTED: pentatricopeptide repeat-containi... 54 5e-06 emb|CAN61593.1| hypothetical protein VITISV_030555 [Vitis vinifera] 54 5e-06 gb|EEF49973.1| pentatricopeptide repeat-containing protein, puta... 54 8e-06 ref|XP_015570363.1| PREDICTED: pentatricopeptide repeat-containi... 54 9e-06 gb|KVH92079.1| hypothetical protein Ccrd_005896 [Cynara carduncu... 54 9e-06 >ref|XP_012857881.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Erythranthe guttata] gi|604345494|gb|EYU44055.1| hypothetical protein MIMGU_mgv1a002435mg [Erythranthe guttata] Length = 675 Score = 68.9 bits (167), Expect = 4e-11 Identities = 37/63 (58%), Positives = 39/63 (61%), Gaps = 2/63 (3%) Frame = +2 Query: 218 MGALHTATTTELLYHPPLAEHSTE--NFTTSNPSQKTILHLLNTKCISSLENLKQAHALI 391 MG L TEL YHPP +H T N SN S K IL LLN KC +S ENLKQ HALI Sbjct: 1 MGVLQIPAITELPYHPPPLQHLTHENNLANSNLSYKAILELLNQKCTNSFENLKQTHALI 60 Query: 392 LKT 400 LKT Sbjct: 61 LKT 63 >ref|XP_011087498.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Sesamum indicum] Length = 666 Score = 67.0 bits (162), Expect = 2e-10 Identities = 38/61 (62%), Positives = 42/61 (68%) Frame = +2 Query: 218 MGALHTATTTELLYHPPLAEHSTENFTTSNPSQKTILHLLNTKCISSLENLKQAHALILK 397 MG L+T+T TEL Y P AE T NPS K IL++LNTKC SL NLKQAHALILK Sbjct: 1 MGILNTSTITELPYIPSPAEPDL----TENPSLKAILNILNTKCTDSLGNLKQAHALILK 56 Query: 398 T 400 T Sbjct: 57 T 57 >ref|XP_010101867.1| hypothetical protein L484_023657 [Morus notabilis] gi|587901740|gb|EXB90004.1| hypothetical protein L484_023657 [Morus notabilis] Length = 616 Score = 64.3 bits (155), Expect = 1e-09 Identities = 37/66 (56%), Positives = 44/66 (66%) Frame = +2 Query: 203 DGQVKMGALHTATTTELLYHPPLAEHSTENFTTSNPSQKTILHLLNTKCISSLENLKQAH 382 +G+ KM T TTT L YH E STE TS SQKTIL L+NTKC +SL LKQAH Sbjct: 23 NGRDKMNPT-TITTTNLPYHFKPTELSTETIPTSKLSQKTILDLINTKCSNSLHYLKQAH 81 Query: 383 ALILKT 400 AL+L++ Sbjct: 82 ALVLRS 87 >ref|XP_015874902.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Ziziphus jujuba] Length = 669 Score = 61.6 bits (148), Expect = 1e-08 Identities = 32/56 (57%), Positives = 41/56 (73%) Frame = +2 Query: 233 TATTTELLYHPPLAEHSTENFTTSNPSQKTILHLLNTKCISSLENLKQAHALILKT 400 T TTT L +H E STE+ +S SQKT+L LLNTKC +SL +LKQAHA+IL++ Sbjct: 5 TTTTTNLPHHLKPKEFSTESKPSSKLSQKTVLDLLNTKCTTSLPHLKQAHAVILRS 60 >ref|XP_010546764.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Tarenaya hassleriana] Length = 666 Score = 60.1 bits (144), Expect = 4e-08 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = +2 Query: 239 TTTELLYHPPLAEHSTENFTTSNPSQKTILHLLNTKCISSLENLKQAHALILKT 400 T T LL+H E ST TSN +QKTIL LLNT+CI+S+ NLKQAHA++L+T Sbjct: 7 TATGLLHHLKPEESSTP---TSNLTQKTILELLNTRCINSVRNLKQAHAIVLRT 57 >ref|XP_015384117.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Citrus sinensis] Length = 601 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/54 (57%), Positives = 39/54 (72%) Frame = +2 Query: 239 TTTELLYHPPLAEHSTENFTTSNPSQKTILHLLNTKCISSLENLKQAHALILKT 400 TTT+L +H E S N TS SQKTIL +LNTKC +S ++LKQAHA+ILK+ Sbjct: 6 TTTDLPHHLKPEEISATNIPTSEFSQKTILDILNTKCHTSWQHLKQAHAVILKS 59 >gb|KDO81649.1| hypothetical protein CISIN_1g006246mg [Citrus sinensis] Length = 654 Score = 58.5 bits (140), Expect = 2e-07 Identities = 31/54 (57%), Positives = 39/54 (72%) Frame = +2 Query: 239 TTTELLYHPPLAEHSTENFTTSNPSQKTILHLLNTKCISSLENLKQAHALILKT 400 TTT+L +H E S N TS SQKTIL +LNTKC +S ++LKQAHA+ILK+ Sbjct: 6 TTTDLPHHLKPEEISATNIPTSEFSQKTILDILNTKCHTSWQHLKQAHAVILKS 59 >emb|CDP15243.1| unnamed protein product [Coffea canephora] Length = 680 Score = 58.5 bits (140), Expect = 2e-07 Identities = 34/67 (50%), Positives = 44/67 (65%), Gaps = 1/67 (1%) Frame = +2 Query: 203 DGQVKMGALHTATTTELLYH-PPLAEHSTENFTTSNPSQKTILHLLNTKCISSLENLKQA 379 D + +MG ATT EL YH P + ++ T N SQKTIL LLNT+C +S E+LKQ Sbjct: 8 DSKQEMGR---ATTAELPYHLAPESHLGQKHLPTFNLSQKTILDLLNTRCSNSYEHLKQV 64 Query: 380 HALILKT 400 HAL++KT Sbjct: 65 HALVVKT 71 >ref|XP_011038940.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Populus euphratica] Length = 665 Score = 56.6 bits (135), Expect = 7e-07 Identities = 31/55 (56%), Positives = 37/55 (67%) Frame = +2 Query: 236 ATTTELLYHPPLAEHSTENFTTSNPSQKTILHLLNTKCISSLENLKQAHALILKT 400 +TTT L YH + TEN TS SQKTIL LLNTK +SL +LKQ HA+ L+T Sbjct: 2 STTTNLPYHLAPKDFPTENKFTSQLSQKTILDLLNTKSSTSLHHLKQVHAVALRT 56 >ref|XP_007207048.1| hypothetical protein PRUPE_ppb025182mg [Prunus persica] gi|462402690|gb|EMJ08247.1| hypothetical protein PRUPE_ppb025182mg [Prunus persica] Length = 672 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/57 (52%), Positives = 41/57 (71%), Gaps = 1/57 (1%) Frame = +2 Query: 233 TATTTELLYHPPLAEHSTENF-TTSNPSQKTILHLLNTKCISSLENLKQAHALILKT 400 + TTT L +H E S E+ +TS SQKTILH+LNTKC +SL++LKQAH + L++ Sbjct: 4 STTTTNLPHHIKPKEVSAESTASTSKLSQKTILHILNTKCTTSLQHLKQAHGVALRS 60 >ref|XP_004304899.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Fragaria vesca subsp. vesca] Length = 673 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/57 (50%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = +2 Query: 233 TATTTELLYHPPLAEHSTENFT-TSNPSQKTILHLLNTKCISSLENLKQAHALILKT 400 T TTT L +H + S E+ T SQKTILH+LN+KC +SL+NLKQAH ++L++ Sbjct: 7 TTTTTNLPHHVKPKQASPESKPPTFKLSQKTILHILNSKCTTSLQNLKQAHGVVLRS 63 >emb|CBI39605.3| unnamed protein product [Vitis vinifera] Length = 624 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/57 (56%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = +2 Query: 233 TATT-TELLYHPPLAEHSTENFTTSNPSQKTILHLLNTKCISSLENLKQAHALILKT 400 TATT TE YH + + TS S K ILHLLNT+C +SL +LKQAHALIL+T Sbjct: 25 TATTATEAPYHHHHLIPNGHSTETSKLSHKAILHLLNTQCTTSLHHLKQAHALILRT 81 >ref|XP_002281942.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910 [Vitis vinifera] Length = 672 Score = 54.7 bits (130), Expect = 3e-06 Identities = 32/57 (56%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = +2 Query: 233 TATT-TELLYHPPLAEHSTENFTTSNPSQKTILHLLNTKCISSLENLKQAHALILKT 400 TATT TE YH + + TS S K ILHLLNT+C +SL +LKQAHALIL+T Sbjct: 4 TATTATEAPYHHHHLIPNGHSTETSKLSHKAILHLLNTQCTTSLHHLKQAHALILRT 60 >ref|XP_008246072.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Prunus mume] Length = 672 Score = 54.3 bits (129), Expect = 5e-06 Identities = 29/60 (48%), Positives = 40/60 (66%), Gaps = 2/60 (3%) Frame = +2 Query: 227 LHTATTTELLYH--PPLAEHSTENFTTSNPSQKTILHLLNTKCISSLENLKQAHALILKT 400 + T+TTT L H P + +TS SQKTILH+LNTKC +SL++LKQAH + L++ Sbjct: 1 MSTSTTTTNLPHRIKPKEVSAESTASTSKLSQKTILHILNTKCTTSLQHLKQAHGVALRS 60 >emb|CAN61593.1| hypothetical protein VITISV_030555 [Vitis vinifera] Length = 673 Score = 54.3 bits (129), Expect = 5e-06 Identities = 33/58 (56%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = +2 Query: 233 TATTTELLYHPPLAE--HSTENFTTSNPSQKTILHLLNTKCISSLENLKQAHALILKT 400 TAT +H L HSTE TS S K ILHLLNT+C +SL +LKQAHALIL+T Sbjct: 7 TATEAPYHHHHHLIPKGHSTE---TSKLSHKAILHLLNTQCTTSLHHLKQAHALILRT 61 >gb|EEF49973.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 422 Score = 53.5 bits (127), Expect = 8e-06 Identities = 30/58 (51%), Positives = 38/58 (65%) Frame = +2 Query: 227 LHTATTTELLYHPPLAEHSTENFTTSNPSQKTILHLLNTKCISSLENLKQAHALILKT 400 +HTATTT H P EN TS +QKTIL LLN+KC +S + LKQ HA+IL++ Sbjct: 1 MHTATTTT---HLPYHLSPAENKPTSKLTQKTILDLLNSKCNASFQYLKQIHAVILRS 55 >ref|XP_015570363.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520, partial [Ricinus communis] Length = 651 Score = 53.5 bits (127), Expect = 9e-06 Identities = 30/58 (51%), Positives = 38/58 (65%) Frame = +2 Query: 227 LHTATTTELLYHPPLAEHSTENFTTSNPSQKTILHLLNTKCISSLENLKQAHALILKT 400 +HTATTT H P EN TS +QKTIL LLN+KC +S + LKQ HA+IL++ Sbjct: 1 MHTATTTT---HLPYHLSPAENKPTSKLTQKTILDLLNSKCNASFQYLKQIHAVILRS 55 >gb|KVH92079.1| hypothetical protein Ccrd_005896 [Cynara cardunculus var. scolymus] Length = 698 Score = 53.5 bits (127), Expect = 9e-06 Identities = 30/61 (49%), Positives = 38/61 (62%) Frame = +2 Query: 218 MGALHTATTTELLYHPPLAEHSTENFTTSNPSQKTILHLLNTKCISSLENLKQAHALILK 397 M A T TT E YH + T+N +QK++L+LL TKC +SL +LKQ HALILK Sbjct: 1 MNAATTTTTVEPPYH---------HLPTNNLTQKSLLNLLTTKCTTSLHHLKQTHALILK 51 Query: 398 T 400 T Sbjct: 52 T 52