BLASTX nr result
ID: Rehmannia28_contig00033983
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00033983 (619 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_054986.1| ORF45 protein [Spinacia oleracea] gi|7636160|em... 53 2e-06 >ref|NP_054986.1| ORF45 protein [Spinacia oleracea] gi|7636160|emb|CAB88782.1| ORF45 protein (chloroplast) [Spinacia oleracea] Length = 45 Score = 52.8 bits (125), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 281 IGYYEFKTSRYGEMVDTLLLGSSARASRFESEWRH 177 +GYY+FK + ++VDTLLLGSSARASRFESE RH Sbjct: 1 MGYYDFKEAAMVKLVDTLLLGSSARASRFESESRH 35