BLASTX nr result
ID: Rehmannia28_contig00033474
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00033474 (715 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097703.1| PREDICTED: probable amino acid permease 7 [S... 64 2e-08 >ref|XP_011097703.1| PREDICTED: probable amino acid permease 7 [Sesamum indicum] Length = 461 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -3 Query: 128 VFGIIYKEIVNMCFQPTERSGTIWTALAHIITAVIGSGGLSL 3 +FG K++V MC P ERSGT+WTALAHIITAVIGSG LSL Sbjct: 8 IFGTKTKKVVTMCVPPVERSGTVWTALAHIITAVIGSGVLSL 49