BLASTX nr result
ID: Rehmannia28_contig00033406
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00033406 (301 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070075.1| PREDICTED: protein kinase and PP2C-like doma... 74 4e-15 ref|XP_011070076.1| PREDICTED: protein kinase and PP2C-like doma... 74 4e-15 ref|XP_011070077.1| PREDICTED: protein kinase and PP2C-like doma... 74 4e-15 ref|XP_011070078.1| PREDICTED: protein kinase and PP2C-like doma... 74 4e-15 ref|XP_012828155.1| PREDICTED: protein kinase and PP2C-like doma... 74 2e-14 ref|XP_006430493.1| hypothetical protein CICLE_v10011248mg [Citr... 74 3e-13 ref|XP_006430492.1| hypothetical protein CICLE_v10011248mg [Citr... 74 3e-13 ref|XP_015165642.1| PREDICTED: protein kinase and PP2C-like doma... 71 3e-13 gb|EPS68638.1| hypothetical protein M569_06125 [Genlisea aurea] 72 4e-13 ref|XP_002283436.1| PREDICTED: protein kinase and PP2C-like doma... 72 9e-13 gb|KDO57434.1| hypothetical protein CISIN_1g005427mg [Citrus sin... 72 1e-12 gb|KDO57433.1| hypothetical protein CISIN_1g005427mg [Citrus sin... 72 1e-12 gb|KDO57430.1| hypothetical protein CISIN_1g005427mg [Citrus sin... 72 1e-12 gb|KDO57431.1| hypothetical protein CISIN_1g005427mg [Citrus sin... 72 1e-12 gb|KDO57432.1| hypothetical protein CISIN_1g005427mg [Citrus sin... 72 1e-12 emb|CDP06260.1| unnamed protein product [Coffea canephora] 69 2e-12 ref|XP_009774310.1| PREDICTED: protein kinase and PP2C-like doma... 68 2e-12 ref|XP_006482024.1| PREDICTED: protein kinase and PP2C-like doma... 70 3e-12 ref|XP_006482023.1| PREDICTED: protein kinase and PP2C-like doma... 70 3e-12 gb|KCW44145.1| hypothetical protein EUGRSUZ_L024451, partial [Eu... 68 6e-12 >ref|XP_011070075.1| PREDICTED: protein kinase and PP2C-like domain-containing protein isoform X1 [Sesamum indicum] Length = 655 Score = 74.3 bits (181), Expect(2) = 4e-15 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L+EAF+KTDI FR+ELNS R+ K IQKD HPGCTAITAL+VKNKL Sbjct: 456 LLEAFVKTDIAFRNELNSRRESKGTIQKDWHPGCTAITALIVKNKL 501 Score = 33.5 bits (75), Expect(2) = 4e-15 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +2 Query: 5 AEASGFSAGALPGFLRNLVPVS 70 A A+ FSAGALPGFL+ L+P+S Sbjct: 429 AAAAEFSAGALPGFLQTLLPMS 450 >ref|XP_011070076.1| PREDICTED: protein kinase and PP2C-like domain-containing protein isoform X2 [Sesamum indicum] Length = 550 Score = 74.3 bits (181), Expect(2) = 4e-15 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L+EAF+KTDI FR+ELNS R+ K IQKD HPGCTAITAL+VKNKL Sbjct: 456 LLEAFVKTDIAFRNELNSRRESKGTIQKDWHPGCTAITALIVKNKL 501 Score = 33.5 bits (75), Expect(2) = 4e-15 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +2 Query: 5 AEASGFSAGALPGFLRNLVPVS 70 A A+ FSAGALPGFL+ L+P+S Sbjct: 429 AAAAEFSAGALPGFLQTLLPMS 450 >ref|XP_011070077.1| PREDICTED: protein kinase and PP2C-like domain-containing protein isoform X3 [Sesamum indicum] Length = 528 Score = 74.3 bits (181), Expect(2) = 4e-15 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L+EAF+KTDI FR+ELNS R+ K IQKD HPGCTAITAL+VKNKL Sbjct: 456 LLEAFVKTDIAFRNELNSRRESKGTIQKDWHPGCTAITALIVKNKL 501 Score = 33.5 bits (75), Expect(2) = 4e-15 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +2 Query: 5 AEASGFSAGALPGFLRNLVPVS 70 A A+ FSAGALPGFL+ L+P+S Sbjct: 429 AAAAEFSAGALPGFLQTLLPMS 450 >ref|XP_011070078.1| PREDICTED: protein kinase and PP2C-like domain-containing protein isoform X4 [Sesamum indicum] Length = 524 Score = 74.3 bits (181), Expect(2) = 4e-15 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L+EAF+KTDI FR+ELNS R+ K IQKD HPGCTAITAL+VKNKL Sbjct: 456 LLEAFVKTDIAFRNELNSRRESKGTIQKDWHPGCTAITALIVKNKL 501 Score = 33.5 bits (75), Expect(2) = 4e-15 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +2 Query: 5 AEASGFSAGALPGFLRNLVPVS 70 A A+ FSAGALPGFL+ L+P+S Sbjct: 429 AAAAEFSAGALPGFLQTLLPMS 450 >ref|XP_012828155.1| PREDICTED: protein kinase and PP2C-like domain-containing protein [Erythranthe guttata] gi|604298586|gb|EYU18588.1| hypothetical protein MIMGU_mgv1a002771mg [Erythranthe guttata] Length = 639 Score = 73.9 bits (180), Expect(2) = 2e-14 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 LVEAF++TDI FR+ELNS RK K VIQKD HPGCTA+TALV+K+KL Sbjct: 440 LVEAFVETDIAFRNELNSRRKSKGVIQKDWHPGCTAMTALVIKDKL 485 Score = 32.0 bits (71), Expect(2) = 2e-14 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = +2 Query: 5 AEASGFSAGALPGFLRNLVPVS 70 A A+ FSAGALPGFLR LV S Sbjct: 413 AAAAEFSAGALPGFLRTLVSKS 434 >ref|XP_006430493.1| hypothetical protein CICLE_v10011248mg [Citrus clementina] gi|557532550|gb|ESR43733.1| hypothetical protein CICLE_v10011248mg [Citrus clementina] Length = 535 Score = 73.6 bits (179), Expect = 3e-13 Identities = 33/46 (71%), Positives = 42/46 (91%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L+EAFI+TD+TFR+EL+SLRK K V+QKD HPGCTAI AL+V+N+L Sbjct: 460 LLEAFIRTDVTFRNELDSLRKSKRVVQKDWHPGCTAIAALIVRNRL 505 >ref|XP_006430492.1| hypothetical protein CICLE_v10011248mg [Citrus clementina] gi|557532549|gb|ESR43732.1| hypothetical protein CICLE_v10011248mg [Citrus clementina] Length = 659 Score = 73.6 bits (179), Expect = 3e-13 Identities = 33/46 (71%), Positives = 42/46 (91%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L+EAFI+TD+TFR+EL+SLRK K V+QKD HPGCTAI AL+V+N+L Sbjct: 460 LLEAFIRTDVTFRNELDSLRKSKRVVQKDWHPGCTAIAALIVRNRL 505 >ref|XP_015165642.1| PREDICTED: protein kinase and PP2C-like domain-containing protein [Solanum tuberosum] Length = 210 Score = 71.2 bits (173), Expect = 3e-13 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L EAFIKTD+TFR++L+S RK K IQKD HPGCTAI AL++KNKL Sbjct: 11 LFEAFIKTDVTFRTQLDSSRKRKGAIQKDWHPGCTAIAALIIKNKL 56 >gb|EPS68638.1| hypothetical protein M569_06125 [Genlisea aurea] Length = 652 Score = 72.0 bits (175), Expect(2) = 4e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L EAFI+ DI FRSEL SLRKFK +I+KD HPGCTA++ALVVKNKL Sbjct: 453 LKEAFIQMDIAFRSELASLRKFKGLIKKDWHPGCTAVSALVVKNKL 498 Score = 29.3 bits (64), Expect(2) = 4e-13 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +2 Query: 11 ASGFSAGALPGFLRNL 58 A+ FSAGALPGFLR+L Sbjct: 428 AAEFSAGALPGFLRSL 443 >ref|XP_002283436.1| PREDICTED: protein kinase and PP2C-like domain-containing protein [Vitis vinifera] gi|297741696|emb|CBI32828.3| unnamed protein product [Vitis vinifera] Length = 659 Score = 72.0 bits (175), Expect = 9e-13 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L+EAF+KTD+ FR+EL+S RK K VIQKD HPGCTA+ AL+V+NKL Sbjct: 460 LLEAFVKTDVAFRNELDSCRKSKGVIQKDWHPGCTAVAALIVRNKL 505 >gb|KDO57434.1| hypothetical protein CISIN_1g005427mg [Citrus sinensis] Length = 573 Score = 71.6 bits (174), Expect = 1e-12 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L+EAFI+TD+ FR+EL+SLRK K V+QKD HPGCTAI AL+V+N+L Sbjct: 498 LLEAFIRTDVAFRNELDSLRKSKRVVQKDWHPGCTAIAALIVRNRL 543 >gb|KDO57433.1| hypothetical protein CISIN_1g005427mg [Citrus sinensis] Length = 578 Score = 71.6 bits (174), Expect = 1e-12 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L+EAFI+TD+ FR+EL+SLRK K V+QKD HPGCTAI AL+V+N+L Sbjct: 498 LLEAFIRTDVAFRNELDSLRKSKRVVQKDWHPGCTAIAALIVRNRL 543 >gb|KDO57430.1| hypothetical protein CISIN_1g005427mg [Citrus sinensis] Length = 628 Score = 71.6 bits (174), Expect = 1e-12 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L+EAFI+TD+ FR+EL+SLRK K V+QKD HPGCTAI AL+V+N+L Sbjct: 429 LLEAFIRTDVAFRNELDSLRKSKRVVQKDWHPGCTAIAALIVRNRL 474 >gb|KDO57431.1| hypothetical protein CISIN_1g005427mg [Citrus sinensis] Length = 658 Score = 71.6 bits (174), Expect = 1e-12 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L+EAFI+TD+ FR+EL+SLRK K V+QKD HPGCTAI AL+V+N+L Sbjct: 459 LLEAFIRTDVAFRNELDSLRKSKRVVQKDWHPGCTAIAALIVRNRL 504 >gb|KDO57432.1| hypothetical protein CISIN_1g005427mg [Citrus sinensis] Length = 697 Score = 71.6 bits (174), Expect = 1e-12 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L+EAFI+TD+ FR+EL+SLRK K V+QKD HPGCTAI AL+V+N+L Sbjct: 498 LLEAFIRTDVAFRNELDSLRKSKRVVQKDWHPGCTAIAALIVRNRL 543 >emb|CDP06260.1| unnamed protein product [Coffea canephora] Length = 654 Score = 68.9 bits (167), Expect(2) = 2e-12 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L EAF+KTD FR EL+S RK K VI+KD HPGCTA+TAL+VKN+L Sbjct: 455 LYEAFVKTDSAFREELDSRRKSKGVIKKDWHPGCTAVTALIVKNRL 500 Score = 30.0 bits (66), Expect(2) = 2e-12 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = +2 Query: 5 AEASGFSAGALPGFLRNLVPVS 70 A A+ FSAGALPGFL+ L +S Sbjct: 428 AAAAEFSAGALPGFLQTLASMS 449 >ref|XP_009774310.1| PREDICTED: protein kinase and PP2C-like domain-containing protein [Nicotiana sylvestris] Length = 653 Score = 67.8 bits (164), Expect(2) = 2e-12 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L EAFIKTD+ FR++L+S RK K +QKD HPGCTAI AL+V+NKL Sbjct: 454 LFEAFIKTDVAFRTQLDSCRKRKGAVQKDWHPGCTAIAALMVRNKL 499 Score = 30.8 bits (68), Expect(2) = 2e-12 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 11 ASGFSAGALPGFLRNLVPVS 70 A+ FSAGALPGFL+NL +S Sbjct: 429 AAEFSAGALPGFLQNLGSIS 448 >ref|XP_006482024.1| PREDICTED: protein kinase and PP2C-like domain-containing protein isoform X2 [Citrus sinensis] Length = 620 Score = 70.5 bits (171), Expect = 3e-12 Identities = 31/46 (67%), Positives = 41/46 (89%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L+EAFI+TD+ FR+EL+SLRK K V+QKD HPGCTA+ AL+V+N+L Sbjct: 421 LLEAFIRTDVAFRNELDSLRKSKRVVQKDWHPGCTAMAALIVRNRL 466 >ref|XP_006482023.1| PREDICTED: protein kinase and PP2C-like domain-containing protein isoform X1 [Citrus sinensis] Length = 659 Score = 70.5 bits (171), Expect = 3e-12 Identities = 31/46 (67%), Positives = 41/46 (89%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L+EAFI+TD+ FR+EL+SLRK K V+QKD HPGCTA+ AL+V+N+L Sbjct: 460 LLEAFIRTDVAFRNELDSLRKSKRVVQKDWHPGCTAMAALIVRNRL 505 >gb|KCW44145.1| hypothetical protein EUGRSUZ_L024451, partial [Eucalyptus grandis] Length = 227 Score = 68.2 bits (165), Expect = 6e-12 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = +1 Query: 163 LVEAFIKTDITFRSELNSLRKFKAVIQKDSHPGCTAITALVVKNKL 300 L+EAFIKTD+ FR+EL++ RK K VIQKD HPGCTAI AL+V+N L Sbjct: 28 LLEAFIKTDMEFRNELDTYRKSKGVIQKDWHPGCTAIVALIVRNML 73