BLASTX nr result
ID: Rehmannia28_contig00033163
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00033163 (386 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100382.1| PREDICTED: OTU domain-containing protein DDB... 74 8e-14 ref|XP_006357883.1| PREDICTED: OTU domain-containing protein DDB... 72 4e-13 ref|XP_004243635.1| PREDICTED: OTU domain-containing protein DDB... 72 4e-13 ref|XP_009626134.1| PREDICTED: OTU domain-containing protein DDB... 69 5e-13 gb|EYU42842.1| hypothetical protein MIMGU_mgv1a013175mg [Erythra... 72 8e-13 gb|KJB10636.1| hypothetical protein B456_001G212800 [Gossypium r... 69 3e-12 ref|XP_012830900.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl... 72 4e-12 ref|XP_009626133.1| PREDICTED: OTU domain-containing protein DDB... 67 5e-12 ref|XP_002274979.1| PREDICTED: OTU domain-containing protein DDB... 69 6e-12 gb|ADE75867.1| unknown [Picea sitchensis] 69 8e-12 ref|XP_012488958.1| PREDICTED: OTU domain-containing protein DDB... 69 8e-12 ref|XP_009757675.1| PREDICTED: OTU domain-containing protein DDB... 69 9e-12 ref|XP_009602224.1| PREDICTED: OTU domain-containing protein DDB... 69 9e-12 ref|XP_011004463.1| PREDICTED: OTU domain-containing protein DDB... 67 1e-11 ref|XP_013751479.1| PREDICTED: OTU domain-containing protein DDB... 68 1e-11 ref|XP_009109006.1| PREDICTED: OTU domain-containing protein DDB... 68 1e-11 ref|XP_009377959.1| PREDICTED: OTU domain-containing protein DDB... 68 2e-11 ref|XP_010036074.1| PREDICTED: OTU domain-containing protein DDB... 68 2e-11 ref|XP_006429758.1| hypothetical protein CICLE_v10012675mg [Citr... 68 2e-11 ref|XP_009377957.1| PREDICTED: OTU domain-containing protein DDB... 68 2e-11 >ref|XP_011100382.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Sesamum indicum] gi|747104311|ref|XP_011100383.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Sesamum indicum] gi|747104313|ref|XP_011100384.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Sesamum indicum] gi|747104315|ref|XP_011100385.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Sesamum indicum] gi|747104317|ref|XP_011100386.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Sesamum indicum] gi|747104319|ref|XP_011100388.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Sesamum indicum] Length = 226 Score = 74.3 bits (181), Expect = 8e-14 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 RELWLSFWSE+HYNSLYQAGEVP RT RKKHWLF Sbjct: 193 RELWLSFWSEVHYNSLYQAGEVPTRTQRKKHWLF 226 >ref|XP_006357883.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Solanum tuberosum] gi|565383148|ref|XP_006357884.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Solanum tuberosum] Length = 232 Score = 72.4 bits (176), Expect = 4e-13 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 RELWLSFWSE+HYNSLY+ GE P+R PRKKHWLF Sbjct: 198 RELWLSFWSEVHYNSLYEIGEAPVRVPRKKHWLF 231 >ref|XP_004243635.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Solanum lycopersicum] gi|723716452|ref|XP_010323942.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Solanum lycopersicum] gi|970039017|ref|XP_015080845.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Solanum pennellii] Length = 232 Score = 72.4 bits (176), Expect = 4e-13 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 RELWLSFWSE+HYNSLY+ GE P+R PRKKHWLF Sbjct: 198 RELWLSFWSEVHYNSLYEIGEAPVRVPRKKHWLF 231 >ref|XP_009626134.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X2 [Nicotiana tomentosiformis] Length = 89 Score = 68.9 bits (167), Expect = 5e-13 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 RELWLSFWSE+HYNSLY+ GEVP R RKKHWLF Sbjct: 56 RELWLSFWSEVHYNSLYEIGEVPARVRRKKHWLF 89 >gb|EYU42842.1| hypothetical protein MIMGU_mgv1a013175mg [Erythranthe guttata] Length = 228 Score = 71.6 bits (174), Expect = 8e-13 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 RELWLSFWSE+HYNSLYQAGEVP R RKKHWLF Sbjct: 195 RELWLSFWSEVHYNSLYQAGEVPTRKHRKKHWLF 228 >gb|KJB10636.1| hypothetical protein B456_001G212800 [Gossypium raimondii] Length = 160 Score = 68.9 bits (167), Expect = 3e-12 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 RE+WLSFWSE+HYNSLY +G+VP R PR+KHWLF Sbjct: 127 REIWLSFWSEVHYNSLYASGDVPTRAPRRKHWLF 160 >ref|XP_012830900.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 82A1 [Erythranthe guttata] Length = 685 Score = 71.6 bits (174), Expect = 4e-12 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 RELWLSFWSE+HYNSLYQAGEVP R RKKHWLF Sbjct: 652 RELWLSFWSEVHYNSLYQAGEVPTRKHRKKHWLF 685 >ref|XP_009626133.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X1 [Nicotiana tomentosiformis] Length = 112 Score = 67.0 bits (162), Expect = 5e-12 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 381 ELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 ELWLSFWSE+HYNSLY+ GEVP R RKKHWLF Sbjct: 80 ELWLSFWSEVHYNSLYEIGEVPARVRRKKHWLF 112 >ref|XP_002274979.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Vitis vinifera] gi|731403021|ref|XP_010654875.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Vitis vinifera] gi|731403023|ref|XP_010654876.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Vitis vinifera] gi|297743628|emb|CBI36495.3| unnamed protein product [Vitis vinifera] Length = 232 Score = 69.3 bits (168), Expect = 6e-12 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 RELWLSFWSE+HYNSLY +G+VP R PRK+HWLF Sbjct: 199 RELWLSFWSEVHYNSLYASGDVPSRAPRKRHWLF 232 >gb|ADE75867.1| unknown [Picea sitchensis] Length = 225 Score = 68.9 bits (167), Expect = 8e-12 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 +ELWLSFWSE+HYNSLY+ GEVPIR +KKHWLF Sbjct: 192 KELWLSFWSEVHYNSLYEIGEVPIRVQKKKHWLF 225 >ref|XP_012488958.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Gossypium raimondii] gi|728846983|gb|KHG26426.1| OTU domain-containing [Gossypium arboreum] gi|763743135|gb|KJB10634.1| hypothetical protein B456_001G212800 [Gossypium raimondii] gi|763743136|gb|KJB10635.1| hypothetical protein B456_001G212800 [Gossypium raimondii] Length = 227 Score = 68.9 bits (167), Expect = 8e-12 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 RE+WLSFWSE+HYNSLY +G+VP R PR+KHWLF Sbjct: 194 REIWLSFWSEVHYNSLYASGDVPTRAPRRKHWLF 227 >ref|XP_009757675.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Nicotiana sylvestris] gi|698521739|ref|XP_009757676.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Nicotiana sylvestris] Length = 233 Score = 68.9 bits (167), Expect = 9e-12 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 RELWLSFWSE+HYNSLY+ GEVP R RKKHWLF Sbjct: 199 RELWLSFWSEVHYNSLYEIGEVPARVRRKKHWLF 232 >ref|XP_009602224.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Nicotiana tomentosiformis] Length = 233 Score = 68.9 bits (167), Expect = 9e-12 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 RELWLSFWSE+HYNSLY+ GEVP R RKKHWLF Sbjct: 199 RELWLSFWSEVHYNSLYEIGEVPARVRRKKHWLF 232 >ref|XP_011004463.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like [Populus euphratica] Length = 174 Score = 67.4 bits (163), Expect = 1e-11 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 RELWLSFWSE+HYNSLY G+VP R RKKHWLF Sbjct: 141 RELWLSFWSEVHYNSLYATGDVPTRVARKKHWLF 174 >ref|XP_013751479.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X2 [Brassica napus] Length = 195 Score = 67.8 bits (164), Expect = 1e-11 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 RE WLSFWSE+HYNSLY +G+VP R PR+KHWLF Sbjct: 162 REAWLSFWSEVHYNSLYSSGDVPTRKPRRKHWLF 195 >ref|XP_009109006.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X2 [Brassica rapa] Length = 195 Score = 67.8 bits (164), Expect = 1e-11 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 RE WLSFWSE+HYNSLY +G+VP R PR+KHWLF Sbjct: 162 REAWLSFWSEVHYNSLYSSGDVPTRKPRRKHWLF 195 >ref|XP_009377959.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X2 [Pyrus x bretschneideri] Length = 202 Score = 67.8 bits (164), Expect = 2e-11 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWL 286 RELWLSFWSE+HYNSLY + +VP RTPRKKHWL Sbjct: 168 RELWLSFWSEVHYNSLYASADVPSRTPRKKHWL 200 >ref|XP_010036074.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Eucalyptus grandis] gi|629081150|gb|KCW47595.1| hypothetical protein EUGRSUZ_K01340 [Eucalyptus grandis] Length = 227 Score = 68.2 bits (165), Expect = 2e-11 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 +ELWLSFWSE+HYNSLY+ G+VP + PRKKHWLF Sbjct: 194 KELWLSFWSEVHYNSLYERGDVPAQKPRKKHWLF 227 >ref|XP_006429758.1| hypothetical protein CICLE_v10012675mg [Citrus clementina] gi|567874339|ref|XP_006429759.1| hypothetical protein CICLE_v10012675mg [Citrus clementina] gi|568855512|ref|XP_006481348.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Citrus sinensis] gi|568855514|ref|XP_006481349.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Citrus sinensis] gi|568855516|ref|XP_006481350.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Citrus sinensis] gi|557531815|gb|ESR42998.1| hypothetical protein CICLE_v10012675mg [Citrus clementina] gi|557531816|gb|ESR42999.1| hypothetical protein CICLE_v10012675mg [Citrus clementina] gi|641845456|gb|KDO64344.1| hypothetical protein CISIN_1g027211mg [Citrus sinensis] gi|641845457|gb|KDO64345.1| hypothetical protein CISIN_1g027211mg [Citrus sinensis] gi|641845458|gb|KDO64346.1| hypothetical protein CISIN_1g027211mg [Citrus sinensis] Length = 226 Score = 67.8 bits (164), Expect = 2e-11 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWLF 283 RELWLSFWSE+HYNSLY G+VP R PRKK+WLF Sbjct: 193 RELWLSFWSEVHYNSLYATGDVPTRKPRKKYWLF 226 >ref|XP_009377957.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X1 [Pyrus x bretschneideri] gi|694406283|ref|XP_009377958.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X1 [Pyrus x bretschneideri] Length = 227 Score = 67.8 bits (164), Expect = 2e-11 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 384 RELWLSFWSEIHYNSLYQAGEVPIRTPRKKHWL 286 RELWLSFWSE+HYNSLY + +VP RTPRKKHWL Sbjct: 193 RELWLSFWSEVHYNSLYASADVPSRTPRKKHWL 225