BLASTX nr result
ID: Rehmannia28_contig00033030
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00033030 (503 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101595.1| PREDICTED: uncharacterized protein LOC105179... 58 8e-07 >ref|XP_011101595.1| PREDICTED: uncharacterized protein LOC105179654 [Sesamum indicum] Length = 765 Score = 57.8 bits (138), Expect = 8e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 502 CRIPTLLQPKVTFTNYIEERAIPVLDPSTST*KK 401 CRIP LLQPKVTF NYI+ERA PV+DPSTS K Sbjct: 731 CRIPALLQPKVTFANYIQERAFPVIDPSTSAQNK 764