BLASTX nr result
ID: Rehmannia28_contig00032945
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00032945 (385 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073274.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 64 2e-09 ref|XP_011080907.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 62 6e-09 ref|XP_009791163.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 61 2e-08 ref|XP_009626433.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 61 2e-08 gb|ABW97851.1| ACS5 [Nicotiana tabacum] 58 2e-07 ref|XP_009757887.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 58 2e-07 gb|AAR99391.1| ACC synthase ACS2 [Nicotiana attenuata] 58 2e-07 emb|CAA67118.1| ACC synthase [Nicotiana tabacum] 58 2e-07 ref|XP_009626021.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 57 6e-07 gb|ABM88785.1| 1-aminocyclopropane-1-carboxylate synthase [Camel... 54 5e-06 gb|AAC15777.1| ACC synthase [Nicotiana glutinosa] 54 5e-06 >ref|XP_011073274.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Sesamum indicum] Length = 481 Score = 63.5 bits (153), Expect = 2e-09 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 3/42 (7%) Frame = -1 Query: 385 ETTARKQCRRSKLEISLSFRRLDEL---PHSPMSSPLVRART 269 E ++R+QCRRSKLEISLSFRRLDE+ HSPMSSP+VRART Sbjct: 440 EASSRRQCRRSKLEISLSFRRLDEIMSPHHSPMSSPMVRART 481 >ref|XP_011080907.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase [Sesamum indicum] Length = 485 Score = 62.4 bits (150), Expect = 6e-09 Identities = 33/48 (68%), Positives = 36/48 (75%), Gaps = 9/48 (18%) Frame = -1 Query: 385 ETTARKQCRRSKLEISLSFRRLDEL---------PHSPMSSPLVRART 269 + + RKQCR SKLEISLSFRRLDE+ PHSPMSSPLVRART Sbjct: 438 QESGRKQCRSSKLEISLSFRRLDEMKMAAPHKMSPHSPMSSPLVRART 485 >ref|XP_009791163.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana sylvestris] Length = 486 Score = 60.8 bits (146), Expect = 2e-08 Identities = 31/47 (65%), Positives = 35/47 (74%), Gaps = 8/47 (17%) Frame = -1 Query: 385 ETTARKQCRRSKLEISLSFRRLDEL--------PHSPMSSPLVRART 269 E +KQCRRSKLEISLSFRRLD+ PHSPMSSP+V+ART Sbjct: 440 EVATKKQCRRSKLEISLSFRRLDDFMNSPFMNSPHSPMSSPMVQART 486 >ref|XP_009626433.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana tomentosiformis] Length = 486 Score = 60.8 bits (146), Expect = 2e-08 Identities = 31/47 (65%), Positives = 35/47 (74%), Gaps = 8/47 (17%) Frame = -1 Query: 385 ETTARKQCRRSKLEISLSFRRLDEL--------PHSPMSSPLVRART 269 E +KQCRRSKLEISLSFRRLD+ PHSPMSSP+V+ART Sbjct: 440 EVATKKQCRRSKLEISLSFRRLDDFMNSPFKNSPHSPMSSPMVQART 486 >gb|ABW97851.1| ACS5 [Nicotiana tabacum] Length = 474 Score = 57.8 bits (138), Expect = 2e-07 Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 3/36 (8%) Frame = -1 Query: 367 QCRRSKLEISLSFRRLDEL---PHSPMSSPLVRART 269 QCRRSKLEISLSFR+LD+ PHSPMSSPLV+ART Sbjct: 439 QCRRSKLEISLSFRKLDDFMNSPHSPMSSPLVQART 474 >ref|XP_009757887.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana sylvestris] Length = 483 Score = 57.8 bits (138), Expect = 2e-07 Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 3/36 (8%) Frame = -1 Query: 367 QCRRSKLEISLSFRRLDEL---PHSPMSSPLVRART 269 QCRRSKLEISLSFR+LD+ PHSPMSSPLV+ART Sbjct: 448 QCRRSKLEISLSFRKLDDFMNSPHSPMSSPLVQART 483 >gb|AAR99391.1| ACC synthase ACS2 [Nicotiana attenuata] Length = 483 Score = 57.8 bits (138), Expect = 2e-07 Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 3/36 (8%) Frame = -1 Query: 367 QCRRSKLEISLSFRRLDEL---PHSPMSSPLVRART 269 QCRRSKLEISLSFR+LD+ PHSPMSSPLV+ART Sbjct: 448 QCRRSKLEISLSFRKLDDFINSPHSPMSSPLVQART 483 >emb|CAA67118.1| ACC synthase [Nicotiana tabacum] Length = 483 Score = 57.8 bits (138), Expect = 2e-07 Identities = 29/36 (80%), Positives = 32/36 (88%), Gaps = 3/36 (8%) Frame = -1 Query: 367 QCRRSKLEISLSFRRLDEL---PHSPMSSPLVRART 269 QCRRSKLEISLSFR+LD+ PHSPMSSPLV+ART Sbjct: 448 QCRRSKLEISLSFRKLDDFMNSPHSPMSSPLVQART 483 >ref|XP_009626021.1| PREDICTED: 1-aminocyclopropane-1-carboxylate synthase-like [Nicotiana tomentosiformis] Length = 483 Score = 56.6 bits (135), Expect = 6e-07 Identities = 28/36 (77%), Positives = 32/36 (88%), Gaps = 3/36 (8%) Frame = -1 Query: 367 QCRRSKLEISLSFRRLDEL---PHSPMSSPLVRART 269 QCRRSKLEI+LSFR+LD+ PHSPMSSPLV+ART Sbjct: 448 QCRRSKLEINLSFRKLDDFMNSPHSPMSSPLVQART 483 >gb|ABM88785.1| 1-aminocyclopropane-1-carboxylate synthase [Camellia sinensis] Length = 477 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/45 (60%), Positives = 35/45 (77%), Gaps = 8/45 (17%) Frame = -1 Query: 379 TARKQCRRSKLEISLSFRRLDEL--------PHSPMSSPLVRART 269 TA++QC +S L++SLSFRRLD++ PHSP+SSPLVRART Sbjct: 433 TAKRQCWQSNLKLSLSFRRLDDIGMAPHMMSPHSPISSPLVRART 477 >gb|AAC15777.1| ACC synthase [Nicotiana glutinosa] Length = 482 Score = 53.9 bits (128), Expect = 5e-06 Identities = 29/43 (67%), Positives = 33/43 (76%), Gaps = 4/43 (9%) Frame = -1 Query: 385 ETTARKQCRRS-KLEISLSFRRLDEL---PHSPMSSPLVRART 269 E +KQCRR K EISLSFRRLD+ PHSPMSSP+V+ART Sbjct: 440 EVATKKQCRRRRKREISLSFRRLDDFMNSPHSPMSSPMVQART 482