BLASTX nr result
ID: Rehmannia28_contig00032746
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00032746 (453 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011091100.1| PREDICTED: geraniol 8-hydroxylase-like [Sesa... 59 2e-07 emb|CDP17802.1| unnamed protein product [Coffea canephora] 57 1e-06 ref|XP_011069673.1| PREDICTED: ferruginol synthase-like [Sesamum... 57 1e-06 gb|AJD25185.1| cytochrome P450 CYP76S7 [Salvia miltiorrhiza] 56 2e-06 ref|XP_011091112.1| PREDICTED: geraniol 8-hydroxylase-like [Sesa... 56 2e-06 gb|AAZ07704.1| cytochrome P450 monooxygenase isoform I [Sesamum ... 56 2e-06 ref|XP_011089001.1| PREDICTED: geraniol 8-hydroxylase-like [Sesa... 55 3e-06 ref|XP_011069674.1| PREDICTED: ferruginol synthase-like [Sesamum... 55 4e-06 emb|CDP17803.1| unnamed protein product [Coffea canephora] 55 4e-06 gb|KCW77280.1| hypothetical protein EUGRSUZ_D01639 [Eucalyptus g... 54 5e-06 emb|CDP20725.1| unnamed protein product [Coffea canephora] 53 7e-06 gb|ERN14972.1| hypothetical protein AMTR_s00032p00218900 [Ambore... 53 9e-06 ref|XP_010038949.1| PREDICTED: geraniol 8-hydroxylase-like [Euca... 54 9e-06 ref|XP_011074592.1| PREDICTED: ferruginol synthase-like, partial... 54 1e-05 gb|EYU25444.1| hypothetical protein MIMGU_mgv1a005818mg [Erythra... 54 1e-05 ref|XP_012851609.1| PREDICTED: ferruginol synthase-like [Erythra... 54 1e-05 ref|XP_011069681.1| PREDICTED: ferruginol synthase-like [Sesamum... 54 1e-05 >ref|XP_011091100.1| PREDICTED: geraniol 8-hydroxylase-like [Sesamum indicum] Length = 499 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/35 (71%), Positives = 33/35 (94%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTKL 345 W+LEE +KP+E++M+E FGLTLQKAIPL+AVPT+L Sbjct: 465 WKLEEGLKPEEVEMDERFGLTLQKAIPLRAVPTQL 499 >emb|CDP17802.1| unnamed protein product [Coffea canephora] Length = 500 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/35 (62%), Positives = 31/35 (88%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTKL 345 W+LE+ +KP+++DM E FGLT+QKA+PLKA+P KL Sbjct: 466 WKLEDGMKPEDMDMEEKFGLTIQKALPLKAIPVKL 500 >ref|XP_011069673.1| PREDICTED: ferruginol synthase-like [Sesamum indicum] Length = 514 Score = 56.6 bits (135), Expect = 1e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTK 348 WELE + PQ++D+NE FGL+L+KAIPLKAVPTK Sbjct: 480 WELEPGITPQDVDLNEKFGLSLKKAIPLKAVPTK 513 >gb|AJD25185.1| cytochrome P450 CYP76S7 [Salvia miltiorrhiza] Length = 494 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTKL 345 W LE ++KPQE+DMNE FGLTLQK +PL+A+PTKL Sbjct: 461 WRLE-SMKPQEIDMNEKFGLTLQKVVPLQAIPTKL 494 >ref|XP_011091112.1| PREDICTED: geraniol 8-hydroxylase-like [Sesamum indicum] Length = 499 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTKL 345 W+LEE +KP+ +DM+E FGLTLQKA+PL AVPT+L Sbjct: 465 WKLEEGLKPEAVDMDERFGLTLQKAVPLVAVPTEL 499 >gb|AAZ07704.1| cytochrome P450 monooxygenase isoform I [Sesamum indicum] Length = 499 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTKL 345 W+LEE +KP+ +DM+E FGLTLQKA+PL AVPT+L Sbjct: 465 WKLEEGLKPEAVDMDERFGLTLQKAVPLVAVPTEL 499 >ref|XP_011089001.1| PREDICTED: geraniol 8-hydroxylase-like [Sesamum indicum] Length = 500 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTKL 345 W+LEE +K +E+DM E FGLTLQKAIPLKA+P KL Sbjct: 463 WKLEEGLKLEEIDMKEKFGLTLQKAIPLKALPLKL 497 >ref|XP_011069674.1| PREDICTED: ferruginol synthase-like [Sesamum indicum] Length = 498 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTK 348 WELE + PQ++D+NE FGL+L+KAIPLK VPTK Sbjct: 464 WELEPGITPQDVDLNEKFGLSLKKAIPLKGVPTK 497 >emb|CDP17803.1| unnamed protein product [Coffea canephora] Length = 499 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTKL 345 W+LE+ +KP++LDM E FGLT+QKA PLKA+P KL Sbjct: 465 WKLEDGMKPEDLDMEEKFGLTVQKAWPLKAIPVKL 499 >gb|KCW77280.1| hypothetical protein EUGRSUZ_D01639 [Eucalyptus grandis] Length = 187 Score = 53.5 bits (127), Expect = 5e-06 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTKL 345 W+LE+ V+P+E+DM E FG+TLQKA PL+A+P K+ Sbjct: 151 WKLEQGVRPKEMDMTEKFGITLQKATPLRAIPMKV 185 >emb|CDP20725.1| unnamed protein product [Coffea canephora] Length = 184 Score = 53.1 bits (126), Expect = 7e-06 Identities = 21/35 (60%), Positives = 31/35 (88%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTKL 345 W+LEE +KP++LDM+E FGL++ KA+PL+A+P KL Sbjct: 150 WKLEEGMKPEDLDMDEKFGLSVPKALPLEAIPVKL 184 >gb|ERN14972.1| hypothetical protein AMTR_s00032p00218900 [Amborella trichopoda] Length = 208 Score = 53.1 bits (126), Expect = 9e-06 Identities = 21/34 (61%), Positives = 29/34 (85%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTK 348 WEL + +KP+E+DM + FG+TLQKA+PL+AVP K Sbjct: 167 WELPDGLKPEEMDMRDKFGVTLQKAVPLEAVPVK 200 >ref|XP_010038949.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis] Length = 261 Score = 53.5 bits (127), Expect = 9e-06 Identities = 21/35 (60%), Positives = 30/35 (85%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTKL 345 W+LE+ V+P+E+DM E FG+TLQKA PL+A+P K+ Sbjct: 225 WKLEQGVRPKEMDMTEKFGITLQKATPLRAIPMKV 259 >ref|XP_011074592.1| PREDICTED: ferruginol synthase-like, partial [Sesamum indicum] Length = 464 Score = 53.9 bits (128), Expect = 1e-05 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTKLCR 339 W+LE + P ELDM E F +LQK +PLKAVP KLCR Sbjct: 419 WKLEGGITPDELDMKEKFQFSLQKVVPLKAVPVKLCR 455 >gb|EYU25444.1| hypothetical protein MIMGU_mgv1a005818mg [Erythranthe guttata] Length = 469 Score = 53.9 bits (128), Expect = 1e-05 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTK 348 W+LE +KP+E+D+NEMFGL+L KA+PLK P K Sbjct: 434 WKLEPGIKPEEMDLNEMFGLSLHKAVPLKTFPVK 467 >ref|XP_012851609.1| PREDICTED: ferruginol synthase-like [Erythranthe guttata] Length = 498 Score = 53.9 bits (128), Expect = 1e-05 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTK 348 W+LE +KP+E+D+NEMFGL+L KA+PLK P K Sbjct: 463 WKLEPGIKPEEMDLNEMFGLSLHKAVPLKTFPVK 496 >ref|XP_011069681.1| PREDICTED: ferruginol synthase-like [Sesamum indicum] Length = 498 Score = 53.9 bits (128), Expect = 1e-05 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = -2 Query: 449 WELEENVKPQELDMNEMFGLTLQKAIPLKAVPTK 348 WE E + PQ++D+NE FG++L+KAIPLKAVPTK Sbjct: 464 WEFEPGITPQDVDLNEKFGVSLKKAIPLKAVPTK 497