BLASTX nr result
ID: Rehmannia28_contig00032684
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00032684 (926 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074014.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_012839030.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 gb|EYU36636.1| hypothetical protein MIMGU_mgv1a001743mg [Erythra... 65 5e-08 gb|KJB14288.1| hypothetical protein B456_002G118000 [Gossypium r... 59 2e-06 gb|KJB14290.1| hypothetical protein B456_002G118000 [Gossypium r... 59 2e-06 ref|XP_012464897.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-06 gb|KJB14289.1| hypothetical protein B456_002G118000 [Gossypium r... 59 3e-06 gb|KJB14291.1| hypothetical protein B456_002G118000 [Gossypium r... 59 3e-06 ref|XP_012464880.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-06 gb|KHF99794.1| hypothetical protein F383_16904 [Gossypium arboreum] 59 3e-06 ref|XP_011074015.1| PREDICTED: pentatricopeptide repeat-containi... 58 6e-06 ref|XP_012067525.1| PREDICTED: pentatricopeptide repeat-containi... 58 8e-06 ref|XP_012067524.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-06 >ref|XP_011074014.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X1 [Sesamum indicum] Length = 816 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/71 (47%), Positives = 51/71 (71%) Frame = +1 Query: 688 GYKMSKPILKQIQENIVNTLHMGQRTRASYLLPKLNFRDQALRVWNFIHILQFWARKLDS 867 G + +PI++ +Q+ IVN LH+G+RTRAS+LL +L QAL+ +FI ILQ+ AR D Sbjct: 43 GSWLREPIVRPMQDEIVNALHLGERTRASHLLSELGREGQALQAADFISILQYCARTPDP 102 Query: 868 VFATDTWKVMK 900 +F +TWK+M+ Sbjct: 103 LFVMETWKLME 113 >ref|XP_012839030.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 [Erythranthe guttata] Length = 819 Score = 70.9 bits (172), Expect = 4e-10 Identities = 34/70 (48%), Positives = 49/70 (70%) Frame = +1 Query: 688 GYKMSKPILKQIQENIVNTLHMGQRTRASYLLPKLNFRDQALRVWNFIHILQFWARKLDS 867 GY+ I +++QE IV LH+G+R+RAS LL +L RD+AL+ +FI ILQ+ AR D Sbjct: 43 GYRPRDSIARRMQEEIVTALHLGERSRASVLLSELGGRDEALQAGDFIPILQYCARTPDP 102 Query: 868 VFATDTWKVM 897 +F +TWK+M Sbjct: 103 LFVMETWKLM 112 >gb|EYU36636.1| hypothetical protein MIMGU_mgv1a001743mg [Erythranthe guttata] Length = 766 Score = 64.7 bits (156), Expect = 5e-08 Identities = 31/59 (52%), Positives = 43/59 (72%) Frame = +1 Query: 721 IQENIVNTLHMGQRTRASYLLPKLNFRDQALRVWNFIHILQFWARKLDSVFATDTWKVM 897 +QE IV LH+G+R+RAS LL +L RD+AL+ +FI ILQ+ AR D +F +TWK+M Sbjct: 1 MQEEIVTALHLGERSRASVLLSELGGRDEALQAGDFIPILQYCARTPDPLFVMETWKLM 59 >gb|KJB14288.1| hypothetical protein B456_002G118000 [Gossypium raimondii] Length = 581 Score = 59.3 bits (142), Expect = 2e-06 Identities = 32/82 (39%), Positives = 52/82 (63%) Frame = +1 Query: 655 SIDGLVKKGGGGYKMSKPILKQIQENIVNTLHMGQRTRASYLLPKLNFRDQALRVWNFIH 834 +I+G V G GG +P+ K IQ IV+ L +G+R+RAS LL +Q+L+ +F++ Sbjct: 39 TINGNVFLGYGG----EPLTKSIQVQIVDALRLGERSRASSLLLDFGNGNQSLKANDFVY 94 Query: 835 ILQFWARKLDSVFATDTWKVMK 900 IL + AR D +F +TW++M+ Sbjct: 95 ILNYCARSPDPLFVMETWRLME 116 >gb|KJB14290.1| hypothetical protein B456_002G118000 [Gossypium raimondii] Length = 599 Score = 59.3 bits (142), Expect = 2e-06 Identities = 32/82 (39%), Positives = 52/82 (63%) Frame = +1 Query: 655 SIDGLVKKGGGGYKMSKPILKQIQENIVNTLHMGQRTRASYLLPKLNFRDQALRVWNFIH 834 +I+G V G GG +P+ K IQ IV+ L +G+R+RAS LL +Q+L+ +F++ Sbjct: 39 TINGNVFLGYGG----EPLTKSIQVQIVDALRLGERSRASSLLLDFGNGNQSLKANDFVY 94 Query: 835 ILQFWARKLDSVFATDTWKVMK 900 IL + AR D +F +TW++M+ Sbjct: 95 ILNYCARSPDPLFVMETWRLME 116 >ref|XP_012464897.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X3 [Gossypium raimondii] Length = 670 Score = 59.3 bits (142), Expect = 3e-06 Identities = 32/82 (39%), Positives = 52/82 (63%) Frame = +1 Query: 655 SIDGLVKKGGGGYKMSKPILKQIQENIVNTLHMGQRTRASYLLPKLNFRDQALRVWNFIH 834 +I+G V G GG +P+ K IQ IV+ L +G+R+RAS LL +Q+L+ +F++ Sbjct: 39 TINGNVFLGYGG----EPLTKSIQVQIVDALRLGERSRASSLLLDFGNGNQSLKANDFVY 94 Query: 835 ILQFWARKLDSVFATDTWKVMK 900 IL + AR D +F +TW++M+ Sbjct: 95 ILNYCARSPDPLFVMETWRLME 116 >gb|KJB14289.1| hypothetical protein B456_002G118000 [Gossypium raimondii] Length = 771 Score = 59.3 bits (142), Expect = 3e-06 Identities = 32/82 (39%), Positives = 52/82 (63%) Frame = +1 Query: 655 SIDGLVKKGGGGYKMSKPILKQIQENIVNTLHMGQRTRASYLLPKLNFRDQALRVWNFIH 834 +I+G V G GG +P+ K IQ IV+ L +G+R+RAS LL +Q+L+ +F++ Sbjct: 39 TINGNVFLGYGG----EPLTKSIQVQIVDALRLGERSRASSLLLDFGNGNQSLKANDFVY 94 Query: 835 ILQFWARKLDSVFATDTWKVMK 900 IL + AR D +F +TW++M+ Sbjct: 95 ILNYCARSPDPLFVMETWRLME 116 >gb|KJB14291.1| hypothetical protein B456_002G118000 [Gossypium raimondii] Length = 777 Score = 59.3 bits (142), Expect = 3e-06 Identities = 32/82 (39%), Positives = 52/82 (63%) Frame = +1 Query: 655 SIDGLVKKGGGGYKMSKPILKQIQENIVNTLHMGQRTRASYLLPKLNFRDQALRVWNFIH 834 +I+G V G GG +P+ K IQ IV+ L +G+R+RAS LL +Q+L+ +F++ Sbjct: 39 TINGNVFLGYGG----EPLTKSIQVQIVDALRLGERSRASSLLLDFGNGNQSLKANDFVY 94 Query: 835 ILQFWARKLDSVFATDTWKVMK 900 IL + AR D +F +TW++M+ Sbjct: 95 ILNYCARSPDPLFVMETWRLME 116 >ref|XP_012464880.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X1 [Gossypium raimondii] gi|763746848|gb|KJB14287.1| hypothetical protein B456_002G118000 [Gossypium raimondii] Length = 817 Score = 59.3 bits (142), Expect = 3e-06 Identities = 32/82 (39%), Positives = 52/82 (63%) Frame = +1 Query: 655 SIDGLVKKGGGGYKMSKPILKQIQENIVNTLHMGQRTRASYLLPKLNFRDQALRVWNFIH 834 +I+G V G GG +P+ K IQ IV+ L +G+R+RAS LL +Q+L+ +F++ Sbjct: 39 TINGNVFLGYGG----EPLTKSIQVQIVDALRLGERSRASSLLLDFGNGNQSLKANDFVY 94 Query: 835 ILQFWARKLDSVFATDTWKVMK 900 IL + AR D +F +TW++M+ Sbjct: 95 ILNYCARSPDPLFVMETWRLME 116 >gb|KHF99794.1| hypothetical protein F383_16904 [Gossypium arboreum] Length = 857 Score = 59.3 bits (142), Expect = 3e-06 Identities = 32/82 (39%), Positives = 52/82 (63%) Frame = +1 Query: 655 SIDGLVKKGGGGYKMSKPILKQIQENIVNTLHMGQRTRASYLLPKLNFRDQALRVWNFIH 834 +I+G V G GG +P+ K IQ IV+ L +G+R+RAS LL +Q+L+ +F++ Sbjct: 39 TINGNVFLGYGG----EPLTKSIQVQIVDALRLGERSRASSLLLDFGNGNQSLKANDFVY 94 Query: 835 ILQFWARKLDSVFATDTWKVMK 900 IL + AR D +F +TW++M+ Sbjct: 95 ILNYCARSPDPLFVMETWRLME 116 >ref|XP_011074015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X2 [Sesamum indicum] Length = 780 Score = 58.2 bits (139), Expect = 6e-06 Identities = 29/59 (49%), Positives = 42/59 (71%) Frame = +1 Query: 688 GYKMSKPILKQIQENIVNTLHMGQRTRASYLLPKLNFRDQALRVWNFIHILQFWARKLD 864 G + +PI++ +Q+ IVN LH+G+RTRAS+LL +L QAL+ +FI ILQ+ AR D Sbjct: 43 GSWLREPIVRPMQDEIVNALHLGERTRASHLLSELGREGQALQAADFISILQYCARTPD 101 >ref|XP_012067525.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X2 [Jatropha curcas] Length = 738 Score = 57.8 bits (138), Expect = 8e-06 Identities = 27/62 (43%), Positives = 44/62 (70%) Frame = +1 Query: 715 KQIQENIVNTLHMGQRTRASYLLPKLNFRDQALRVWNFIHILQFWARKLDSVFATDTWKV 894 K IQ+ IV+ L++G+R RAS+LL L+ + +LR +F IL++ AR D +FA +TW++ Sbjct: 58 KSIQKQIVDALYLGERGRASHLLLDLSHANNSLRANDFADILKYCARSPDPLFAMETWRI 117 Query: 895 MK 900 M+ Sbjct: 118 MR 119 >ref|XP_012067524.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280 isoform X1 [Jatropha curcas] gi|643735349|gb|KDP41990.1| hypothetical protein JCGZ_27008 [Jatropha curcas] Length = 828 Score = 57.8 bits (138), Expect = 9e-06 Identities = 27/62 (43%), Positives = 44/62 (70%) Frame = +1 Query: 715 KQIQENIVNTLHMGQRTRASYLLPKLNFRDQALRVWNFIHILQFWARKLDSVFATDTWKV 894 K IQ+ IV+ L++G+R RAS+LL L+ + +LR +F IL++ AR D +FA +TW++ Sbjct: 58 KSIQKQIVDALYLGERGRASHLLLDLSHANNSLRANDFADILKYCARSPDPLFAMETWRI 117 Query: 895 MK 900 M+ Sbjct: 118 MR 119