BLASTX nr result
ID: Rehmannia28_contig00032664
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00032664 (337 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098349.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 76 5e-14 ref|XP_012850698.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 59 7e-08 >ref|XP_011098349.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP37, chloroplastic [Sesamum indicum] Length = 505 Score = 76.3 bits (186), Expect = 5e-14 Identities = 44/70 (62%), Positives = 50/70 (71%) Frame = +1 Query: 127 MAFPLSASIFSPNKLSLNLSPTPSTPKSISLLTTHFAFPYNRVPREFTLARGFSHKFNRI 306 MAFPLSASIFSPNKLSLNLS T + + S TTHFA PY PRE A+ S +F I Sbjct: 1 MAFPLSASIFSPNKLSLNLSSTRKS--TSSSFTTHFALPY--TPREPASAKHISPEFKCI 56 Query: 307 LAKKDNGPME 336 LA+KD+GPME Sbjct: 57 LARKDDGPME 66 >ref|XP_012850698.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP37, chloroplastic [Erythranthe guttata] gi|604312915|gb|EYU26409.1| hypothetical protein MIMGU_mgv1a006178mg [Erythranthe guttata] Length = 454 Score = 58.5 bits (140), Expect = 7e-08 Identities = 38/70 (54%), Positives = 42/70 (60%) Frame = +1 Query: 127 MAFPLSASIFSPNKLSLNLSPTPSTPKSISLLTTHFAFPYNRVPREFTLARGFSHKFNRI 306 MA PLSAS FSPN LSL+ S STP+ SL TT F+ R S KF+RI Sbjct: 1 MAVPLSASTFSPNSLSLHRS---STPQLTSLFTTRFS------------RRQISPKFSRI 45 Query: 307 LAKKDNGPME 336 LAKKDNG ME Sbjct: 46 LAKKDNGSME 55