BLASTX nr result
ID: Rehmannia28_contig00032278
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00032278 (341 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31860.1| hypothetical protein MIMGU_mgv1a023983mg, partial... 66 2e-10 ref|XP_012844046.1| PREDICTED: acyltransferase-like protein At3g... 66 2e-10 gb|KDO46469.1| hypothetical protein CISIN_1g0160231mg, partial [... 57 1e-08 ref|XP_011045777.1| PREDICTED: acyltransferase-like protein At3g... 60 2e-08 ref|XP_002300135.2| hypothetical protein POPTR_0001s33160g [Popu... 60 2e-08 ref|XP_002300134.2| hypothetical protein POPTR_0001s33190g [Popu... 60 3e-08 ref|XP_011045774.1| PREDICTED: acyltransferase-like protein At3g... 60 3e-08 ref|XP_009610411.1| PREDICTED: acyltransferase-like protein At3g... 59 8e-08 ref|XP_009610410.1| PREDICTED: acyltransferase-like protein At3g... 59 8e-08 ref|XP_009800266.1| PREDICTED: acyltransferase-like protein At3g... 59 8e-08 ref|XP_010315903.1| PREDICTED: acyltransferase-like protein At3g... 58 2e-07 ref|XP_015065810.1| PREDICTED: acyltransferase-like protein At3g... 58 2e-07 ref|XP_004231751.1| PREDICTED: acyltransferase-like protein At3g... 58 2e-07 ref|XP_006446988.1| hypothetical protein CICLE_v10015254mg [Citr... 57 3e-07 ref|XP_006446989.1| hypothetical protein CICLE_v10015254mg [Citr... 57 3e-07 ref|XP_006468852.1| PREDICTED: acyltransferase-like protein At3g... 57 3e-07 ref|XP_011098940.1| PREDICTED: acyltransferase-like protein At3g... 57 4e-07 gb|EPS71771.1| hypothetical protein M569_02985, partial [Genlise... 57 4e-07 ref|XP_006338726.1| PREDICTED: acyltransferase-like protein At3g... 57 4e-07 ref|XP_011098939.1| PREDICTED: acyltransferase-like protein At3g... 57 4e-07 >gb|EYU31860.1| hypothetical protein MIMGU_mgv1a023983mg, partial [Erythranthe guttata] Length = 624 Score = 66.2 bits (160), Expect = 2e-10 Identities = 27/35 (77%), Positives = 34/35 (97%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFDFNEAP 105 KRE+DPYRN+FARL+Y+ATHGFD+EVPTFDF ++P Sbjct: 590 KRENDPYRNMFARLTYKATHGFDAEVPTFDFTKSP 624 >ref|XP_012844046.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic [Erythranthe guttata] Length = 722 Score = 66.2 bits (160), Expect = 2e-10 Identities = 27/35 (77%), Positives = 34/35 (97%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFDFNEAP 105 KRE+DPYRN+FARL+Y+ATHGFD+EVPTFDF ++P Sbjct: 688 KRENDPYRNMFARLTYKATHGFDAEVPTFDFTKSP 722 >gb|KDO46469.1| hypothetical protein CISIN_1g0160231mg, partial [Citrus sinensis] Length = 83 Score = 57.0 bits (136), Expect = 1e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRE+DPYRNI ARL YQATHGF S+VPTFD Sbjct: 53 KRENDPYRNILARLIYQATHGFTSQVPTFD 82 >ref|XP_011045777.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic [Populus euphratica] Length = 661 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRESDPYRNI ARL+YQA+HGFD+EVPTFD Sbjct: 631 KRESDPYRNILARLAYQASHGFDAEVPTFD 660 >ref|XP_002300135.2| hypothetical protein POPTR_0001s33160g [Populus trichocarpa] gi|550348757|gb|EEE84940.2| hypothetical protein POPTR_0001s33160g [Populus trichocarpa] Length = 723 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRESDPYRNI ARL+YQA+HGFD+EVPTFD Sbjct: 693 KRESDPYRNILARLAYQASHGFDAEVPTFD 722 >ref|XP_002300134.2| hypothetical protein POPTR_0001s33190g [Populus trichocarpa] gi|550348759|gb|EEE84939.2| hypothetical protein POPTR_0001s33190g [Populus trichocarpa] Length = 579 Score = 59.7 bits (143), Expect = 3e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRESDPYRN+ ARL+YQ+THGFDSEVPTF+ Sbjct: 549 KRESDPYRNLLARLAYQSTHGFDSEVPTFE 578 >ref|XP_011045774.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic [Populus euphratica] Length = 716 Score = 59.7 bits (143), Expect = 3e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRESDPYRN+ ARL+YQ+THGFDSEVPTF+ Sbjct: 686 KRESDPYRNLLARLAYQSTHGFDSEVPTFE 715 >ref|XP_009610411.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic isoform X2 [Nicotiana tomentosiformis] Length = 456 Score = 58.5 bits (140), Expect = 8e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRE+DPYRNI AR+ YQATHGF+SEVPTFD Sbjct: 426 KRENDPYRNIMARIVYQATHGFESEVPTFD 455 >ref|XP_009610410.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic isoform X1 [Nicotiana tomentosiformis] Length = 542 Score = 58.5 bits (140), Expect = 8e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRE+DPYRNI AR+ YQATHGF+SEVPTFD Sbjct: 512 KRENDPYRNIMARIVYQATHGFESEVPTFD 541 >ref|XP_009800266.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic [Nicotiana sylvestris] Length = 694 Score = 58.5 bits (140), Expect = 8e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRE+DPYRNI AR+ YQA+HGFDSEVPTFD Sbjct: 664 KRENDPYRNIMARIVYQASHGFDSEVPTFD 693 >ref|XP_010315903.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic isoform X2 [Solanum lycopersicum] Length = 682 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRESD YRNI ARL YQA+HGFDSEVPTFD Sbjct: 652 KRESDSYRNIMARLPYQASHGFDSEVPTFD 681 >ref|XP_015065810.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic [Solanum pennellii] Length = 685 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRESD YRNI ARL YQA+HGFDSEVPTFD Sbjct: 655 KRESDSYRNIMARLPYQASHGFDSEVPTFD 684 >ref|XP_004231751.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic isoform X1 [Solanum lycopersicum] Length = 685 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRESD YRNI ARL YQA+HGFDSEVPTFD Sbjct: 655 KRESDSYRNIMARLPYQASHGFDSEVPTFD 684 >ref|XP_006446988.1| hypothetical protein CICLE_v10015254mg [Citrus clementina] gi|557549599|gb|ESR60228.1| hypothetical protein CICLE_v10015254mg [Citrus clementina] Length = 375 Score = 57.0 bits (136), Expect = 3e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRE+DPYRNI ARL YQATHGF S+VPTFD Sbjct: 345 KRENDPYRNILARLIYQATHGFTSQVPTFD 374 >ref|XP_006446989.1| hypothetical protein CICLE_v10015254mg [Citrus clementina] gi|557549600|gb|ESR60229.1| hypothetical protein CICLE_v10015254mg [Citrus clementina] Length = 444 Score = 57.0 bits (136), Expect = 3e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRE+DPYRNI ARL YQATHGF S+VPTFD Sbjct: 414 KRENDPYRNILARLIYQATHGFTSQVPTFD 443 >ref|XP_006468852.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic isoform X1 [Citrus sinensis] Length = 701 Score = 57.0 bits (136), Expect = 3e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRE+DPYRNI ARL YQATHGF S+VPTFD Sbjct: 671 KRENDPYRNILARLIYQATHGFTSQVPTFD 700 >ref|XP_011098940.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic isoform X2 [Sesamum indicum] Length = 591 Score = 56.6 bits (135), Expect = 4e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRE+D YRNIFARL+YQA HGFD EVPTFD Sbjct: 561 KRENDGYRNIFARLAYQARHGFDCEVPTFD 590 >gb|EPS71771.1| hypothetical protein M569_02985, partial [Genlisea aurea] Length = 620 Score = 56.6 bits (135), Expect = 4e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRE+DPYRNIFARL+YQ +GFDSEVPTF+ Sbjct: 590 KRENDPYRNIFARLAYQTVNGFDSEVPTFE 619 >ref|XP_006338726.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic [Solanum tuberosum] Length = 688 Score = 56.6 bits (135), Expect = 4e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRE+D YRNI ARL YQA+HGFDSEVPTFD Sbjct: 658 KRENDSYRNIMARLPYQASHGFDSEVPTFD 687 >ref|XP_011098939.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic isoform X1 [Sesamum indicum] Length = 711 Score = 56.6 bits (135), Expect = 4e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 1 KRESDPYRNIFARLSYQATHGFDSEVPTFD 90 KRE+D YRNIFARL+YQA HGFD EVPTFD Sbjct: 681 KRENDGYRNIFARLAYQARHGFDCEVPTFD 710