BLASTX nr result
ID: Rehmannia28_contig00032225
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00032225 (362 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27097.1| hypothetical protein MIMGU_mgv1a025766mg, partial... 58 1e-07 ref|XP_012849603.1| PREDICTED: disease resistance protein RPM1-l... 58 1e-07 >gb|EYU27097.1| hypothetical protein MIMGU_mgv1a025766mg, partial [Erythranthe guttata] Length = 938 Score = 58.2 bits (139), Expect = 1e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 262 MAECAVVFVLDKLTILLEEKVNLIKDVKKEIEY 360 MAE AVVFVLDKLT LLE+KVNLIKDVK+EIEY Sbjct: 1 MAELAVVFVLDKLTTLLEDKVNLIKDVKREIEY 33 >ref|XP_012849603.1| PREDICTED: disease resistance protein RPM1-like [Erythranthe guttata] Length = 960 Score = 58.2 bits (139), Expect = 1e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 262 MAECAVVFVLDKLTILLEEKVNLIKDVKKEIEY 360 MAE AVVFVLDKLT LLE+KVNLIKDVK+EIEY Sbjct: 1 MAELAVVFVLDKLTTLLEDKVNLIKDVKREIEY 33