BLASTX nr result
ID: Rehmannia28_contig00032205
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00032205 (364 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_037472680.1| hypothetical protein [Simplicispira psychrop... 63 3e-11 >ref|WP_037472680.1| hypothetical protein [Simplicispira psychrophila] Length = 59 Score = 63.2 bits (152), Expect = 3e-11 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = +1 Query: 178 PPGCKDNYMGWLRSGYLGSRRENRVLASGLACDCAVPEARLKSD 309 PPGCK ++ W +GYLG+ +++RVLA G+ACDCA+ +ARLKSD Sbjct: 15 PPGCKVIHISWFWAGYLGTEQDSRVLAFGIACDCAMTKARLKSD 58