BLASTX nr result
ID: Rehmannia28_contig00032052
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00032052 (359 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68060.1| hypothetical protein M569_06712, partial [Genlise... 52 7e-06 gb|EYU21811.1| hypothetical protein MIMGU_mgv1a022564mg, partial... 53 9e-06 >gb|EPS68060.1| hypothetical protein M569_06712, partial [Genlisea aurea] Length = 150 Score = 51.6 bits (122), Expect = 7e-06 Identities = 22/29 (75%), Positives = 26/29 (89%) Frame = +3 Query: 273 QVKFKIFKECLPLSENSLRQIIRENYTGS 359 QVKF IFKECLPL E+S+RQ+I+ENY GS Sbjct: 90 QVKFSIFKECLPLQESSMRQLIKENYVGS 118 >gb|EYU21811.1| hypothetical protein MIMGU_mgv1a022564mg, partial [Erythranthe guttata] Length = 326 Score = 52.8 bits (125), Expect = 9e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 264 FHFQVKFKIFKECLPLSENSLRQIIRENYTGS 359 F QVKFKIFKECLPL E+SLR +I+ENY GS Sbjct: 157 FPAQVKFKIFKECLPLPESSLRHVIQENYAGS 188