BLASTX nr result
ID: Rehmannia28_contig00030858
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00030858 (406 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094503.1| PREDICTED: uncharacterized transmembrane pro... 62 8e-09 ref|XP_012834777.1| PREDICTED: transcription elongation factor s... 61 3e-08 gb|EYU39646.1| hypothetical protein MIMGU_mgv1a000183mg [Erythra... 61 3e-08 >ref|XP_011094503.1| PREDICTED: uncharacterized transmembrane protein DDB_G0289901 [Sesamum indicum] gi|747093402|ref|XP_011094504.1| PREDICTED: uncharacterized transmembrane protein DDB_G0289901 [Sesamum indicum] Length = 1720 Score = 62.4 bits (150), Expect = 8e-09 Identities = 30/40 (75%), Positives = 31/40 (77%) Frame = +3 Query: 195 AKGEEKVTDGGRKGKWNSSGRGDDDKTGRKRKNRGVFQFF 314 AKG+EKV DG KGK S GDDDKTGRKRKNRGV QFF Sbjct: 4 AKGKEKVIDGSGKGKRKLSSGGDDDKTGRKRKNRGVLQFF 43 >ref|XP_012834777.1| PREDICTED: transcription elongation factor spt5 [Erythranthe guttata] Length = 1464 Score = 60.8 bits (146), Expect = 3e-08 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +3 Query: 198 KGEEKVTDGGRKGKWNSSGRGDDDKTGRKRKNRGVFQFF 314 KG+EKVTDGG KGK GDDDKTGRKRKNRGV QFF Sbjct: 5 KGKEKVTDGGGKGK-RKLNAGDDDKTGRKRKNRGVLQFF 42 >gb|EYU39646.1| hypothetical protein MIMGU_mgv1a000183mg [Erythranthe guttata] Length = 1476 Score = 60.8 bits (146), Expect = 3e-08 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +3 Query: 198 KGEEKVTDGGRKGKWNSSGRGDDDKTGRKRKNRGVFQFF 314 KG+EKVTDGG KGK GDDDKTGRKRKNRGV QFF Sbjct: 5 KGKEKVTDGGGKGK-RKLNAGDDDKTGRKRKNRGVLQFF 42