BLASTX nr result
ID: Rehmannia28_contig00030829
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00030829 (1218 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087320.1| PREDICTED: pentatricopeptide repeat-containi... 122 2e-26 ref|XP_011087319.1| PREDICTED: pentatricopeptide repeat-containi... 122 2e-26 ref|XP_011087317.1| PREDICTED: pentatricopeptide repeat-containi... 122 2e-26 gb|EYU34910.1| hypothetical protein MIMGU_mgv1a001179mg [Erythra... 105 5e-21 gb|EYU24289.1| hypothetical protein MIMGU_mgv1a024266mg [Erythra... 105 5e-21 gb|EYU23583.1| hypothetical protein MIMGU_mgv1a001176mg [Erythra... 105 5e-21 ref|XP_012854029.1| PREDICTED: pentatricopeptide repeat-containi... 105 5e-21 ref|XP_012853142.1| PREDICTED: pentatricopeptide repeat-containi... 105 5e-21 ref|XP_012840386.1| PREDICTED: pentatricopeptide repeat-containi... 105 5e-21 emb|CDP03192.1| unnamed protein product [Coffea canephora] 102 7e-20 emb|CDP14158.1| unnamed protein product [Coffea canephora] 99 7e-19 ref|XP_011625483.1| PREDICTED: pentatricopeptide repeat-containi... 91 7e-19 gb|KVI11106.1| Pentatricopeptide repeat-containing protein [Cyna... 98 2e-18 gb|KYP32453.1| hypothetical protein KK1_046875 [Cajanus cajan] 95 8e-18 ref|XP_004498496.1| PREDICTED: pentatricopeptide repeat-containi... 96 1e-17 emb|CBI25813.3| unnamed protein product [Vitis vinifera] 92 1e-17 ref|XP_008451345.1| PREDICTED: pentatricopeptide repeat-containi... 96 1e-17 ref|XP_008451344.1| PREDICTED: pentatricopeptide repeat-containi... 96 1e-17 ref|XP_008451343.1| PREDICTED: pentatricopeptide repeat-containi... 96 1e-17 ref|XP_008451342.1| PREDICTED: pentatricopeptide repeat-containi... 96 1e-17 >ref|XP_011087320.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X3 [Sesamum indicum] Length = 984 Score = 122 bits (305), Expect = 2e-26 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FALI+K SS KIRIFKNLRICGDCHEF+KFVSGTMNQEIVVRD N FHHFRHGLCSCKDY Sbjct: 924 FALISKLSSGKIRIFKNLRICGDCHEFMKFVSGTMNQEIVVRDINRFHHFRHGLCSCKDY 983 Query: 183 W 185 W Sbjct: 984 W 984 >ref|XP_011087319.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X2 [Sesamum indicum] Length = 1003 Score = 122 bits (305), Expect = 2e-26 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FALI+K SS KIRIFKNLRICGDCHEF+KFVSGTMNQEIVVRD N FHHFRHGLCSCKDY Sbjct: 943 FALISKLSSGKIRIFKNLRICGDCHEFMKFVSGTMNQEIVVRDINRFHHFRHGLCSCKDY 1002 Query: 183 W 185 W Sbjct: 1003 W 1003 >ref|XP_011087317.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X1 [Sesamum indicum] gi|747080154|ref|XP_011087318.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X1 [Sesamum indicum] Length = 1032 Score = 122 bits (305), Expect = 2e-26 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FALI+K SS KIRIFKNLRICGDCHEF+KFVSGTMNQEIVVRD N FHHFRHGLCSCKDY Sbjct: 972 FALISKLSSGKIRIFKNLRICGDCHEFMKFVSGTMNQEIVVRDINRFHHFRHGLCSCKDY 1031 Query: 183 W 185 W Sbjct: 1032 W 1032 >gb|EYU34910.1| hypothetical protein MIMGU_mgv1a001179mg [Erythranthe guttata] Length = 872 Score = 105 bits (263), Expect = 5e-21 Identities = 46/61 (75%), Positives = 54/61 (88%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FALI+K + +IRIFKNLRICGDCHEFIK VS T++QEIVVRD + FHHFR+G+CSCKDY Sbjct: 812 FALISKVNGGRIRIFKNLRICGDCHEFIKCVSSTVDQEIVVRDASRFHHFRNGICSCKDY 871 Query: 183 W 185 W Sbjct: 872 W 872 >gb|EYU24289.1| hypothetical protein MIMGU_mgv1a024266mg [Erythranthe guttata] Length = 872 Score = 105 bits (263), Expect = 5e-21 Identities = 46/61 (75%), Positives = 54/61 (88%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FALI+K + +IRIFKNLRICGDCHEFIK VS T++QEIVVRD + FHHFR+G+CSCKDY Sbjct: 812 FALISKVNGGRIRIFKNLRICGDCHEFIKCVSSTVDQEIVVRDASRFHHFRNGICSCKDY 871 Query: 183 W 185 W Sbjct: 872 W 872 >gb|EYU23583.1| hypothetical protein MIMGU_mgv1a001176mg [Erythranthe guttata] Length = 872 Score = 105 bits (263), Expect = 5e-21 Identities = 46/61 (75%), Positives = 54/61 (88%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FALI+K + +IRIFKNLRICGDCHEFIK VS T++QEIVVRD + FHHFR+G+CSCKDY Sbjct: 812 FALISKVNGGRIRIFKNLRICGDCHEFIKCVSSTVDQEIVVRDASRFHHFRNGICSCKDY 871 Query: 183 W 185 W Sbjct: 872 W 872 >ref|XP_012854029.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Erythranthe guttata] Length = 999 Score = 105 bits (263), Expect = 5e-21 Identities = 46/61 (75%), Positives = 54/61 (88%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FALI+K + +IRIFKNLRICGDCHEFIK VS T++QEIVVRD + FHHFR+G+CSCKDY Sbjct: 939 FALISKVNGGRIRIFKNLRICGDCHEFIKCVSSTVDQEIVVRDASRFHHFRNGICSCKDY 998 Query: 183 W 185 W Sbjct: 999 W 999 >ref|XP_012853142.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Erythranthe guttata] gi|848908341|ref|XP_012853143.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Erythranthe guttata] Length = 999 Score = 105 bits (263), Expect = 5e-21 Identities = 46/61 (75%), Positives = 54/61 (88%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FALI+K + +IRIFKNLRICGDCHEFIK VS T++QEIVVRD + FHHFR+G+CSCKDY Sbjct: 939 FALISKVNGGRIRIFKNLRICGDCHEFIKCVSSTVDQEIVVRDASRFHHFRNGICSCKDY 998 Query: 183 W 185 W Sbjct: 999 W 999 >ref|XP_012840386.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Erythranthe guttata] gi|848880003|ref|XP_012840387.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Erythranthe guttata] Length = 999 Score = 105 bits (263), Expect = 5e-21 Identities = 46/61 (75%), Positives = 54/61 (88%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FALI+K + +IRIFKNLRICGDCHEFIK VS T++QEIVVRD + FHHFR+G+CSCKDY Sbjct: 939 FALISKVNGGRIRIFKNLRICGDCHEFIKCVSSTVDQEIVVRDASRFHHFRNGICSCKDY 998 Query: 183 W 185 W Sbjct: 999 W 999 >emb|CDP03192.1| unnamed protein product [Coffea canephora] Length = 938 Score = 102 bits (254), Expect = 7e-20 Identities = 42/61 (68%), Positives = 53/61 (86%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FAL++ +S++IRIFKNLRICGDCHEF+K VS N+EIV+RD+N FHHF +G+CSCKDY Sbjct: 878 FALVSNANSRRIRIFKNLRICGDCHEFMKGVSDITNKEIVIRDSNRFHHFHNGICSCKDY 937 Query: 183 W 185 W Sbjct: 938 W 938 >emb|CDP14158.1| unnamed protein product [Coffea canephora] Length = 1008 Score = 99.4 bits (246), Expect = 7e-19 Identities = 41/61 (67%), Positives = 51/61 (83%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FAL++ + +IRIFKNLRICGDCHEF+K VS N+EIV+RD+N FHHF +G+CSCKDY Sbjct: 948 FALVSNANGGRIRIFKNLRICGDCHEFMKGVSDITNKEIVIRDSNRFHHFHNGICSCKDY 1007 Query: 183 W 185 W Sbjct: 1008 W 1008 >ref|XP_011625483.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Amborella trichopoda] Length = 98 Score = 90.5 bits (223), Expect = 7e-19 Identities = 37/61 (60%), Positives = 47/61 (77%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 F LI+ + + IR+ KNLR+C +CHE IKFVSG +EIV+RDTN FHHF+ G+CSC DY Sbjct: 38 FGLISVEGGRPIRVMKNLRVCTECHEAIKFVSGYAGREIVLRDTNRFHHFKDGVCSCGDY 97 Query: 183 W 185 W Sbjct: 98 W 98 >gb|KVI11106.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 945 Score = 97.8 bits (242), Expect = 2e-18 Identities = 39/61 (63%), Positives = 50/61 (81%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 F+LIN +S+K +RIFKNLRICGDCHE++K VS N++IV+RD FHHF+ G CSC+DY Sbjct: 885 FSLINNNSNKMVRIFKNLRICGDCHEYMKLVSSIKNKDIVIRDAKRFHHFQDGACSCQDY 944 Query: 183 W 185 W Sbjct: 945 W 945 >gb|KYP32453.1| hypothetical protein KK1_046875 [Cajanus cajan] Length = 470 Score = 95.1 bits (235), Expect = 8e-18 Identities = 40/61 (65%), Positives = 47/61 (77%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FAL+N S IRI KN+R+CGDCH IK+VS + +EI+VRDTN FHHFR GLCSC DY Sbjct: 410 FALLNTPSGSAIRIMKNIRVCGDCHSAIKYVSLVVKREIIVRDTNRFHHFRDGLCSCGDY 469 Query: 183 W 185 W Sbjct: 470 W 470 >ref|XP_004498496.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial [Cicer arietinum] Length = 660 Score = 95.5 bits (236), Expect = 1e-17 Identities = 39/61 (63%), Positives = 47/61 (77%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FAL+N IRI KN+R+CGDCH IK+VS + +EI+VRDTN FHHFR GLCSC+DY Sbjct: 600 FALLNTSQGSTIRIMKNIRVCGDCHSAIKYVSLVVKREIIVRDTNRFHHFRDGLCSCRDY 659 Query: 183 W 185 W Sbjct: 660 W 660 >emb|CBI25813.3| unnamed protein product [Vitis vinifera] Length = 286 Score = 92.4 bits (228), Expect = 1e-17 Identities = 38/61 (62%), Positives = 47/61 (77%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 F LI+ SK IRIFKNLR+CGDCH IK++S +EIVVRD+N FHH ++G+CSC DY Sbjct: 226 FGLISTSQSKPIRIFKNLRVCGDCHTAIKYISMATGREIVVRDSNRFHHIKNGVCSCNDY 285 Query: 183 W 185 W Sbjct: 286 W 286 >ref|XP_008451345.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X6 [Cucumis melo] Length = 786 Score = 95.5 bits (236), Expect = 1e-17 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FALI+ S KKIRIFKNLRICGDCH+ +K +S +QEIVVRD FHHF++G CSC D+ Sbjct: 726 FALISTSSKKKIRIFKNLRICGDCHDVMKHISSITHQEIVVRDVRRFHHFKNGACSCNDF 785 Query: 183 W 185 W Sbjct: 786 W 786 >ref|XP_008451344.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X5 [Cucumis melo] Length = 851 Score = 95.5 bits (236), Expect = 1e-17 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FALI+ S KKIRIFKNLRICGDCH+ +K +S +QEIVVRD FHHF++G CSC D+ Sbjct: 791 FALISTSSKKKIRIFKNLRICGDCHDVMKHISSITHQEIVVRDVRRFHHFKNGACSCNDF 850 Query: 183 W 185 W Sbjct: 851 W 851 >ref|XP_008451343.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X4 [Cucumis melo] Length = 872 Score = 95.5 bits (236), Expect = 1e-17 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FALI+ S KKIRIFKNLRICGDCH+ +K +S +QEIVVRD FHHF++G CSC D+ Sbjct: 812 FALISTSSKKKIRIFKNLRICGDCHDVMKHISSITHQEIVVRDVRRFHHFKNGACSCNDF 871 Query: 183 W 185 W Sbjct: 872 W 872 >ref|XP_008451342.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X3 [Cucumis melo] Length = 971 Score = 95.5 bits (236), Expect = 1e-17 Identities = 40/61 (65%), Positives = 48/61 (78%) Frame = +3 Query: 3 FALINKDSSKKIRIFKNLRICGDCHEFIKFVSGTMNQEIVVRDTNHFHHFRHGLCSCKDY 182 FALI+ S KKIRIFKNLRICGDCH+ +K +S +QEIVVRD FHHF++G CSC D+ Sbjct: 911 FALISTSSKKKIRIFKNLRICGDCHDVMKHISSITHQEIVVRDVRRFHHFKNGACSCNDF 970 Query: 183 W 185 W Sbjct: 971 W 971