BLASTX nr result
ID: Rehmannia28_contig00030555
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00030555 (322 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012838197.1| PREDICTED: allene oxide synthase, chloroplas... 71 3e-12 >ref|XP_012838197.1| PREDICTED: allene oxide synthase, chloroplastic, partial [Erythranthe guttata] Length = 898 Score = 70.9 bits (172), Expect = 3e-12 Identities = 43/98 (43%), Positives = 60/98 (61%), Gaps = 4/98 (4%) Frame = +1 Query: 7 SPLALSPPPRNCC**SVHLRRRHTSTAPLQFFLVIVSSGFPILDH*FELKTLVWRLHLPI 186 SPL+ +PP + ++ +STA F V++ FP L+H FELK L+WR HLPI Sbjct: 14 SPLSFAPPLQLPLAVKLYFL---SSTAGDNFHSVLLI--FPNLEHQFELKPLLWRAHLPI 68 Query: 187 SSQCSDKLTILEN----ESNFELRPTVINANPIKIDPN 288 S+ C+ + T+ N +S+FEL P +NANPIKI PN Sbjct: 69 SAPCTRRPTVRRNDSMGQSHFELLPATLNANPIKISPN 106