BLASTX nr result
ID: Rehmannia28_contig00030541
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00030541 (302 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009049684.1| hypothetical protein (mitochondrion) [Capsic... 57 2e-07 ref|YP_002720155.1| ycf2 [Jatropha curcas] gi|225544184|ref|YP_0... 57 3e-07 gb|AGW04709.1| hypothetical chloroplast protein [Matelea biflora] 56 4e-07 ref|YP_009164603.1| hypothetical protein Ycf2 (chloroplast) [Lat... 56 4e-07 gb|AHH30482.1| hypothetical chloroplast RF2 (chloroplast) [Barts... 56 4e-07 gb|ABD16780.1| probable ATPase, partial (chloroplast) [Eucalyptu... 55 5e-07 ref|YP_008999976.1| hypothetical chloroplast RF21 (chloroplast) ... 56 5e-07 ref|XP_007136982.1| hypothetical protein PHAVU_009G090300g, part... 55 6e-07 gb|KMT17235.1| hypothetical protein BVRB_2g039360 [Beta vulgaris... 55 6e-07 ref|XP_006404502.1| hypothetical protein EUTSA_v10011098mg [Eutr... 55 6e-07 gb|EEF36790.1| conserved hypothetical protein [Ricinus communis] 55 6e-07 emb|CAN82922.1| hypothetical protein VITISV_033139 [Vitis vinifera] 55 6e-07 gb|EEF42587.1| conserved hypothetical protein [Ricinus communis] 55 6e-07 ref|XP_007154152.1| hypothetical protein PHAVU_003G094800g, part... 55 6e-07 ref|XP_002868411.1| hypothetical protein ARALYDRAFT_330174 [Arab... 55 6e-07 emb|CDY19677.1| BnaC09g29330D [Brassica napus] 55 6e-07 ref|XP_002893930.1| hypothetical protein ARALYDRAFT_891293 [Arab... 55 6e-07 ref|XP_013441630.1| Ycf2-like protein, partial [Medicago truncat... 55 6e-07 emb|CDX95209.1| BnaC09g16610D [Brassica napus] 55 6e-07 gb|AFS89534.1| putative RF2 protein, partial (chloroplast) [Frag... 55 6e-07 >ref|YP_009049684.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751956|gb|AIG90042.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 585 Score = 56.6 bits (135), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 211 FGSFETFELAKAMSPCIIWIPNIHDLDVNE 300 FG+ + FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 30 FGTLQ-FELAKAMSPCIIWIPNIHDLDVNE 58 >ref|YP_002720155.1| ycf2 [Jatropha curcas] gi|225544184|ref|YP_002720174.1| ycf2 [Jatropha curcas] gi|224979607|gb|ACN72734.1| ycf2 [Jatropha curcas] gi|224979625|gb|ACN72752.1| ycf2 [Jatropha curcas] Length = 2298 Score = 56.6 bits (135), Expect = 3e-07 Identities = 31/59 (52%), Positives = 34/59 (57%), Gaps = 9/59 (15%) Frame = +1 Query: 151 DICKIYSYPLIFKTESNLMGFGSFET---------FELAKAMSPCIIWIPNIHDLDVNE 300 DI + + L F T N + G FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 1709 DIDRDFDTELEFLTRMNALTMGMMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNE 1767 >gb|AGW04709.1| hypothetical chloroplast protein [Matelea biflora] Length = 1992 Score = 56.2 bits (134), Expect = 4e-07 Identities = 31/52 (59%), Positives = 33/52 (63%) Frame = +1 Query: 145 PFDICKIYSYPLIFKTESNLMGFGSFETFELAKAMSPCIIWIPNIHDLDVNE 300 P DI +Y PL + NL FELAKAMSPCIIWIPNIHDLDV E Sbjct: 1420 PPDIVLLYKMPLFYL---NLQ-------FELAKAMSPCIIWIPNIHDLDVKE 1461 >ref|YP_009164603.1| hypothetical protein Ycf2 (chloroplast) [Lathraea squamaria] gi|927372320|ref|YP_009164611.1| hypothetical protein Ycf2 (chloroplast) [Lathraea squamaria] gi|746590319|gb|AJD76835.1| hypothetical protein Ycf2 (chloroplast) [Lathraea squamaria] gi|746590327|gb|AJD76843.1| hypothetical protein Ycf2 (chloroplast) [Lathraea squamaria] Length = 2261 Score = 56.2 bits (134), Expect = 4e-07 Identities = 28/40 (70%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = +1 Query: 190 TESNLMGFGSFET---FELAKAMSPCIIWIPNIHDLDVNE 300 T + G G F FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 1694 TMDMMSGIGRFYITLQFELAKAMSPCIIWIPNIHDLDVNE 1733 >gb|AHH30482.1| hypothetical chloroplast RF2 (chloroplast) [Bartsia inaequalis] gi|576598331|gb|AHH30493.1| hypothetical chloroplast RF2 (chloroplast) [Bartsia inaequalis] Length = 2269 Score = 56.2 bits (134), Expect = 4e-07 Identities = 28/40 (70%), Positives = 29/40 (72%), Gaps = 3/40 (7%) Frame = +1 Query: 190 TESNLMGFGSFET---FELAKAMSPCIIWIPNIHDLDVNE 300 T + G G F FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 1701 TMDMMSGIGRFYITLQFELAKAMSPCIIWIPNIHDLDVNE 1740 >gb|ABD16780.1| probable ATPase, partial (chloroplast) [Eucalyptus cinerea] Length = 269 Score = 55.5 bits (132), Expect = 5e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 229 FELAKAMSPCIIWIPNIHDLDVNE 300 FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 48 FELAKAMSPCIIWIPNIHDLDVNE 71 >ref|YP_008999976.1| hypothetical chloroplast RF21 (chloroplast) (chloroplast) [Agrostemma githago] gi|576303675|ref|YP_008999993.1| hypothetical chloroplast RF21 (chloroplast) (chloroplast) [Agrostemma githago] gi|555944063|gb|AGZ17967.1| hypothetical chloroplast RF21 (chloroplast) [Agrostemma githago] gi|555944080|gb|AGZ17984.1| hypothetical chloroplast RF21 (chloroplast) [Agrostemma githago] Length = 2043 Score = 55.8 bits (133), Expect = 5e-07 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +1 Query: 211 FGSFETFELAKAMSPCIIWIPNIHDLDVNE 300 F S FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 1483 FYSTLQFELAKAMSPCIIWIPNIHDLDVNE 1512 >ref|XP_007136982.1| hypothetical protein PHAVU_009G090300g, partial [Phaseolus vulgaris] gi|561010069|gb|ESW08976.1| hypothetical protein PHAVU_009G090300g, partial [Phaseolus vulgaris] Length = 335 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 229 FELAKAMSPCIIWIPNIHDLDVNE 300 FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 149 FELAKAMSPCIIWIPNIHDLDVNE 172 >gb|KMT17235.1| hypothetical protein BVRB_2g039360 [Beta vulgaris subsp. vulgaris] Length = 405 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 229 FELAKAMSPCIIWIPNIHDLDVNE 300 FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 244 FELAKAMSPCIIWIPNIHDLDVNE 267 >ref|XP_006404502.1| hypothetical protein EUTSA_v10011098mg [Eutrema salsugineum] gi|557105621|gb|ESQ45955.1| hypothetical protein EUTSA_v10011098mg [Eutrema salsugineum] Length = 422 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 229 FELAKAMSPCIIWIPNIHDLDVNE 300 FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 132 FELAKAMSPCIIWIPNIHDLDVNE 155 >gb|EEF36790.1| conserved hypothetical protein [Ricinus communis] Length = 458 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 229 FELAKAMSPCIIWIPNIHDLDVNE 300 FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 277 FELAKAMSPCIIWIPNIHDLDVNE 300 >emb|CAN82922.1| hypothetical protein VITISV_033139 [Vitis vinifera] Length = 502 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 229 FELAKAMSPCIIWIPNIHDLDVNE 300 FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 29 FELAKAMSPCIIWIPNIHDLDVNE 52 >gb|EEF42587.1| conserved hypothetical protein [Ricinus communis] Length = 518 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 229 FELAKAMSPCIIWIPNIHDLDVNE 300 FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 229 FELAKAMSPCIIWIPNIHDLDVNE 252 >ref|XP_007154152.1| hypothetical protein PHAVU_003G094800g, partial [Phaseolus vulgaris] gi|561027506|gb|ESW26146.1| hypothetical protein PHAVU_003G094800g, partial [Phaseolus vulgaris] Length = 559 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 229 FELAKAMSPCIIWIPNIHDLDVNE 300 FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 137 FELAKAMSPCIIWIPNIHDLDVNE 160 >ref|XP_002868411.1| hypothetical protein ARALYDRAFT_330174 [Arabidopsis lyrata subsp. lyrata] gi|297314247|gb|EFH44670.1| hypothetical protein ARALYDRAFT_330174 [Arabidopsis lyrata subsp. lyrata] Length = 690 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 229 FELAKAMSPCIIWIPNIHDLDVNE 300 FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 171 FELAKAMSPCIIWIPNIHDLDVNE 194 >emb|CDY19677.1| BnaC09g29330D [Brassica napus] Length = 707 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 229 FELAKAMSPCIIWIPNIHDLDVNE 300 FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 551 FELAKAMSPCIIWIPNIHDLDVNE 574 >ref|XP_002893930.1| hypothetical protein ARALYDRAFT_891293 [Arabidopsis lyrata subsp. lyrata] gi|297339772|gb|EFH70189.1| hypothetical protein ARALYDRAFT_891293 [Arabidopsis lyrata subsp. lyrata] Length = 855 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 229 FELAKAMSPCIIWIPNIHDLDVNE 300 FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 299 FELAKAMSPCIIWIPNIHDLDVNE 322 >ref|XP_013441630.1| Ycf2-like protein, partial [Medicago truncatula] gi|657368988|gb|KEH15655.1| Ycf2-like protein, partial [Medicago truncatula] Length = 903 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 229 FELAKAMSPCIIWIPNIHDLDVNE 300 FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 425 FELAKAMSPCIIWIPNIHDLDVNE 448 >emb|CDX95209.1| BnaC09g16610D [Brassica napus] Length = 1118 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 229 FELAKAMSPCIIWIPNIHDLDVNE 300 FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 962 FELAKAMSPCIIWIPNIHDLDVNE 985 >gb|AFS89534.1| putative RF2 protein, partial (chloroplast) [Fragaria chiloensis] Length = 1209 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 229 FELAKAMSPCIIWIPNIHDLDVNE 300 FELAKAMSPCIIWIPNIHDLDVNE Sbjct: 656 FELAKAMSPCIIWIPNIHDLDVNE 679