BLASTX nr result
ID: Rehmannia28_contig00030539
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00030539 (518 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094832.1| PREDICTED: pentatricopeptide repeat-containi... 79 3e-14 >ref|XP_011094832.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Sesamum indicum] gi|747094012|ref|XP_011094833.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Sesamum indicum] Length = 768 Score = 79.3 bits (194), Expect = 3e-14 Identities = 48/97 (49%), Positives = 50/97 (51%), Gaps = 5/97 (5%) Frame = -3 Query: 276 MAFSSCLKCLPCFPSHNLNHTLLCHQ-----KVTSFPFPRICLEQPXXXXXXXXXXXXXX 112 MAFSSCLKC P PSHN N L HQ KVTS PFPRI + QP Sbjct: 1 MAFSSCLKCHPWAPSHNPNLPFLFHQNSEPAKVTSLPFPRINVRQPSGLSCAVSSGLSSI 60 Query: 111 XXSPDFXXXXXXXXXXXXXXXTSALRLFQWASKQPNF 1 SPDF TSALR+FQWASKQPNF Sbjct: 61 SLSPDFSPKQLLDTLRCEENETSALRIFQWASKQPNF 97