BLASTX nr result
ID: Rehmannia28_contig00029928
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00029928 (384 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013456191.1| hypothetical protein MTR_4g065063 [Medicago ... 56 5e-07 gb|KYP74521.1| hypothetical protein KK1_007205, partial [Cajanus... 52 1e-06 gb|ABN08838.1| Thioredoxin-like fold [Medicago truncatula] 54 2e-06 gb|ABN06084.1| Polynucleotidyl transferase, Ribonuclease H fold ... 55 2e-06 gb|ABD32189.2| Polynucleotidyl transferase, Ribonuclease H fold ... 55 2e-06 ref|XP_007028202.1| Retrotransposon, unclassified-like protein [... 54 3e-06 ref|XP_012836341.1| PREDICTED: uncharacterized protein LOC105956... 54 4e-06 gb|ABD28498.2| Polynucleotidyl transferase, Ribonuclease H fold ... 54 5e-06 gb|KYP76107.1| Putative ribonuclease H protein At1g65750 [Cajanu... 54 7e-06 ref|XP_012075337.1| PREDICTED: uncharacterized protein LOC105636... 54 8e-06 gb|EEF41810.1| conserved hypothetical protein [Ricinus communis] 51 8e-06 gb|KYP71523.1| hypothetical protein KK1_010786 [Cajanus cajan] 49 9e-06 gb|KYP50889.1| Putative ribonuclease H protein At1g65750 family ... 51 1e-05 >ref|XP_013456191.1| hypothetical protein MTR_4g065063 [Medicago truncatula] gi|657388259|gb|KEH30222.1| hypothetical protein MTR_4g065063 [Medicago truncatula] Length = 216 Score = 55.8 bits (133), Expect = 5e-07 Identities = 22/57 (38%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = -3 Query: 379 YTMKTGYKILVNSIIDENFGVIEA-WGKIWNLPIPAKIKFFIWRVC*NCLPTSNSLS 212 Y++K+ Y++ V+ +I+ + +E W K+W+LPIP K+K F+WR+ +CLP S++ Sbjct: 53 YSVKSAYRVCVDVLINRDEWKVEGDWNKLWSLPIPPKVKHFMWRLGRDCLPNRQSIT 109 >gb|KYP74521.1| hypothetical protein KK1_007205, partial [Cajanus cajan] Length = 53 Score = 51.6 bits (122), Expect = 1e-06 Identities = 18/35 (51%), Positives = 26/35 (74%) Frame = -3 Query: 307 WGKIWNLPIPAKIKFFIWRVC*NCLPTSNSLSHKG 203 W +W L +PAK+K F+WRVC +CLPT ++L +G Sbjct: 2 WKMLWKLDVPAKVKIFLWRVCRDCLPTRSNLQSRG 36 >gb|ABN08838.1| Thioredoxin-like fold [Medicago truncatula] Length = 198 Score = 54.3 bits (129), Expect = 2e-06 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 3/63 (4%) Frame = -3 Query: 382 AYTMKTGYKILVN---SIIDENFGVIEAWGKIWNLPIPAKIKFFIWRVC*NCLPTSNSLS 212 AY++K+ YK ++N S++ V W +W+L +P K+K F+WR C NCLPT L Sbjct: 15 AYSVKSAYKDILNHDVSVVQHR--VSGNWNCVWSLKLPPKVKNFLWRACRNCLPTRICLQ 72 Query: 211 HKG 203 KG Sbjct: 73 VKG 75 >gb|ABN06084.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 519 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Frame = -3 Query: 379 YTMKTGYKILVNSIIDENFGVIEA-WGKIWNLPIPAKIKFFIWRVC*NCLPTSNSLSHKG 203 Y++++ Y + V +ID +F W IW L +P KIK F+WRVC LPT N L KG Sbjct: 143 YSVRSAYTLCVEELIDTSFLRRPGYWSDIWRLKVPPKIKNFMWRVCRGVLPTRNKLRDKG 202 >gb|ABD32189.2| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 612 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Frame = -3 Query: 379 YTMKTGYKILVNSIIDENFGVIEA-WGKIWNLPIPAKIKFFIWRVC*NCLPTSNSLSHKG 203 Y++++ Y + V +ID +F W IW L +P KIK F+WRVC LPT N L KG Sbjct: 236 YSVRSAYTLCVEELIDTSFLRRPGYWSDIWRLKVPPKIKNFMWRVCRGVLPTRNKLRDKG 295 >ref|XP_007028202.1| Retrotransposon, unclassified-like protein [Theobroma cacao] gi|508716807|gb|EOY08704.1| Retrotransposon, unclassified-like protein [Theobroma cacao] Length = 279 Score = 54.3 bits (129), Expect = 3e-06 Identities = 33/85 (38%), Positives = 47/85 (55%), Gaps = 14/85 (16%) Frame = -3 Query: 379 YTMKTGYKILVNSIIDENFGV--------IEAWGKIWNLPIPAKIKFFIWRVC*NCLPTS 224 Y +K GYK+L ++D N G + W KIWNL IP KI FIWR+ +CLPT Sbjct: 59 YEVKLGYKLLC--MLDGNTGTSASSNDDAFKVWKKIWNLHIPRKILVFIWRIFHSCLPTR 116 Query: 223 NSLSHKGKAKE------FQTLETHI 167 +L+ + A + QT+ET++ Sbjct: 117 VALAKRKVAIDTICPLCSQTVETNL 141 >ref|XP_012836341.1| PREDICTED: uncharacterized protein LOC105956976 [Erythranthe guttata] Length = 1350 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/66 (40%), Positives = 39/66 (59%), Gaps = 11/66 (16%) Frame = -3 Query: 379 YTMKTGYKILVNS-IIDENFGVIEA----------WGKIWNLPIPAKIKFFIWRVC*NCL 233 YT+K+GY +++NS + +N IE W +W LP+P KIK F+WR C N L Sbjct: 1007 YTVKSGYHMILNSPLFLKNHSGIEHGSGSGGSNRNWNLVWKLPLPQKIKLFLWRFCGNNL 1066 Query: 232 PTSNSL 215 PT++ L Sbjct: 1067 PTNSEL 1072 >gb|ABD28498.2| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 424 Score = 53.9 bits (128), Expect = 5e-06 Identities = 25/60 (41%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Frame = -3 Query: 379 YTMKTGY-KILVNSIIDENFGVIEAWGKIWNLPIPAKIKFFIWRVC*NCLPTSNSLSHKG 203 Y++++ Y IL N+ V +W IWNL +P K+K F+WR C NCLPT L +G Sbjct: 188 YSIRSAYCDILNNNTALNQHRVNGSWNSIWNLKLPPKVKNFMWRACRNCLPTRVKLQSRG 247 >gb|KYP76107.1| Putative ribonuclease H protein At1g65750 [Cajanus cajan] Length = 682 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/60 (41%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Frame = -3 Query: 379 YTMKTGYKILVNSIIDEN-FGVIEAWGKIWNLPIPAKIKFFIWRVC*NCLPTSNSLSHKG 203 +T+++ YK + +S++ N + W IW+LPIPAK+K WRV N LPT L KG Sbjct: 336 FTVRSAYKAITSSLLPTNTMDPDKTWNIIWSLPIPAKVKHHTWRVYKNILPTRAQLQKKG 395 >ref|XP_012075337.1| PREDICTED: uncharacterized protein LOC105636626 [Jatropha curcas] Length = 1127 Score = 53.5 bits (127), Expect = 8e-06 Identities = 21/60 (35%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = -3 Query: 379 YTMKTGYKILVNSIIDENFGVIEA-WGKIWNLPIPAKIKFFIWRVC*NCLPTSNSLSHKG 203 Y++K+GYK++ + +D + + W +W+L IP K++ F+WR C + LP SL +G Sbjct: 790 YSVKSGYKVVASQYVDVEDDLRSSFWKSLWSLKIPPKVRHFLWRCCRDILPVKTSLERRG 849 >gb|EEF41810.1| conserved hypothetical protein [Ricinus communis] Length = 127 Score = 51.2 bits (121), Expect = 8e-06 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 4/59 (6%) Frame = -3 Query: 379 YTMKTGYKILVNSIIDENFGV----IEAWGKIWNLPIPAKIKFFIWRVC*NCLPTSNSL 215 YTMK+G ++ +S EN + I W K+W L IP ++K F+WR+C +CLP SL Sbjct: 11 YTMKSGCRVAFDS---ENGHIWVNNIHDWSKLWALEIPPRVKVFLWRLCNHCLPLKVSL 66 >gb|KYP71523.1| hypothetical protein KK1_010786 [Cajanus cajan] Length = 55 Score = 49.3 bits (116), Expect = 9e-06 Identities = 21/32 (65%), Positives = 23/32 (71%) Frame = -3 Query: 298 IWNLPIPAKIKFFIWRVC*NCLPTSNSLSHKG 203 IWNLPI AK+K F+WRVC CLPT L KG Sbjct: 7 IWNLPIHAKVKSFVWRVCHGCLPTRFRLQTKG 38 >gb|KYP50889.1| Putative ribonuclease H protein At1g65750 family [Cajanus cajan] Length = 138 Score = 51.2 bits (121), Expect = 1e-05 Identities = 27/61 (44%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Frame = -3 Query: 382 AYTMKTGYK-ILVNSIIDENFGVIEAWGKIWNLPIPAKIKFFIWRVC*NCLPTSNSLSHK 206 +YT+++ YK L + + N V W IWNL IP KIK FIWR+ + LPT +L K Sbjct: 48 SYTVRSAYKGYLQHCLSMGNLNVPGPWKNIWNLRIPHKIKHFIWRLMRDILPTRPNLQKK 107 Query: 205 G 203 G Sbjct: 108 G 108