BLASTX nr result
ID: Rehmannia28_contig00029828
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00029828 (450 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083296.1| PREDICTED: regulator of nonsense transcripts... 68 2e-10 ref|XP_011083289.1| PREDICTED: regulator of nonsense transcripts... 68 2e-10 gb|EPS68456.1| hypothetical protein M569_06311, partial [Genlise... 61 4e-08 ref|XP_012852701.1| PREDICTED: regulator of nonsense transcripts... 59 3e-07 gb|EYU24490.1| hypothetical protein MIMGU_mgv1a000416mg [Erythra... 59 3e-07 ref|XP_012852700.1| PREDICTED: regulator of nonsense transcripts... 59 3e-07 ref|XP_009778348.1| PREDICTED: regulator of nonsense transcripts... 59 3e-07 ref|XP_009601343.1| PREDICTED: regulator of nonsense transcripts... 57 1e-06 ref|XP_010319853.1| PREDICTED: regulator of nonsense transcripts... 56 2e-06 ref|XP_015073456.1| PREDICTED: regulator of nonsense transcripts... 56 2e-06 ref|XP_010319848.1| PREDICTED: regulator of nonsense transcripts... 56 2e-06 ref|XP_006340545.1| PREDICTED: regulator of nonsense transcripts... 55 6e-06 >ref|XP_011083296.1| PREDICTED: regulator of nonsense transcripts UPF2 isoform X2 [Sesamum indicum] Length = 1185 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/37 (78%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = -3 Query: 448 GRVANRGRTWDGHGRAG-PRHRHLYHSGAGFYYGRRR 341 GRV NRG TWDGH R+G RHRH+YHSGAG YYGRRR Sbjct: 1149 GRVTNRGHTWDGHNRSGGSRHRHIYHSGAGVYYGRRR 1185 >ref|XP_011083289.1| PREDICTED: regulator of nonsense transcripts UPF2 isoform X1 [Sesamum indicum] Length = 1189 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/37 (78%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = -3 Query: 448 GRVANRGRTWDGHGRAG-PRHRHLYHSGAGFYYGRRR 341 GRV NRG TWDGH R+G RHRH+YHSGAG YYGRRR Sbjct: 1153 GRVTNRGHTWDGHNRSGGSRHRHIYHSGAGVYYGRRR 1189 >gb|EPS68456.1| hypothetical protein M569_06311, partial [Genlisea aurea] Length = 932 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/37 (72%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Frame = -3 Query: 448 GRVANRGRTWDGHGRAGP-RHRHLYHSGAGFYYGRRR 341 GR NRG TWDG+ R G RHRH+ HSGAGFYYGRRR Sbjct: 896 GRTVNRGLTWDGYHRGGGGRHRHISHSGAGFYYGRRR 932 >ref|XP_012852701.1| PREDICTED: regulator of nonsense transcripts UPF2 isoform X2 [Erythranthe guttata] Length = 1088 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 2/38 (5%) Frame = -3 Query: 448 GRVANRGRTWDGHGRA--GPRHRHLYHSGAGFYYGRRR 341 GRV+N TWDG R G RHRH+YHSGAG YYGRRR Sbjct: 1051 GRVSNTRPTWDGQSRTSGGSRHRHIYHSGAGIYYGRRR 1088 >gb|EYU24490.1| hypothetical protein MIMGU_mgv1a000416mg [Erythranthe guttata] Length = 1169 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 2/38 (5%) Frame = -3 Query: 448 GRVANRGRTWDGHGRA--GPRHRHLYHSGAGFYYGRRR 341 GRV+N TWDG R G RHRH+YHSGAG YYGRRR Sbjct: 1132 GRVSNTRPTWDGQSRTSGGSRHRHIYHSGAGIYYGRRR 1169 >ref|XP_012852700.1| PREDICTED: regulator of nonsense transcripts UPF2 isoform X1 [Erythranthe guttata] Length = 1190 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/38 (68%), Positives = 28/38 (73%), Gaps = 2/38 (5%) Frame = -3 Query: 448 GRVANRGRTWDGHGRA--GPRHRHLYHSGAGFYYGRRR 341 GRV+N TWDG R G RHRH+YHSGAG YYGRRR Sbjct: 1153 GRVSNTRPTWDGQSRTSGGSRHRHIYHSGAGIYYGRRR 1190 >ref|XP_009778348.1| PREDICTED: regulator of nonsense transcripts UPF2 [Nicotiana sylvestris] gi|698584382|ref|XP_009778349.1| PREDICTED: regulator of nonsense transcripts UPF2 [Nicotiana sylvestris] Length = 1191 Score = 58.5 bits (140), Expect = 3e-07 Identities = 26/36 (72%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = -3 Query: 445 RVANRGRTWDGHGR-AGPRHRHLYHSGAGFYYGRRR 341 RVA+RG TWD GR +G RHR+LYHSG G YYGRRR Sbjct: 1156 RVAHRGNTWDAPGRGSGSRHRYLYHSGGGLYYGRRR 1191 >ref|XP_009601343.1| PREDICTED: regulator of nonsense transcripts UPF2 [Nicotiana tomentosiformis] gi|697184651|ref|XP_009601344.1| PREDICTED: regulator of nonsense transcripts UPF2 [Nicotiana tomentosiformis] Length = 1195 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/36 (69%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = -3 Query: 445 RVANRGRTWDGHGR-AGPRHRHLYHSGAGFYYGRRR 341 RVA+RG WD GR +G RHR+LYHSG G YYGRRR Sbjct: 1160 RVAHRGNAWDAPGRGSGSRHRYLYHSGGGLYYGRRR 1195 >ref|XP_010319853.1| PREDICTED: regulator of nonsense transcripts UPF2 isoform X2 [Solanum lycopersicum] Length = 1125 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/36 (69%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = -3 Query: 445 RVANRGRTWDGHGR-AGPRHRHLYHSGAGFYYGRRR 341 RVA+RG TWD GR +G RHR+L+HSG G YYGRRR Sbjct: 1090 RVAHRGSTWDAPGRGSGSRHRYLHHSGGGLYYGRRR 1125 >ref|XP_015073456.1| PREDICTED: regulator of nonsense transcripts UPF2 [Solanum pennellii] gi|970024294|ref|XP_015073457.1| PREDICTED: regulator of nonsense transcripts UPF2 [Solanum pennellii] Length = 1198 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/36 (69%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = -3 Query: 445 RVANRGRTWDGHGR-AGPRHRHLYHSGAGFYYGRRR 341 RVA+RG TWD GR +G RHR+L+HSG G YYGRRR Sbjct: 1163 RVAHRGSTWDAPGRGSGSRHRYLHHSGGGLYYGRRR 1198 >ref|XP_010319848.1| PREDICTED: regulator of nonsense transcripts UPF2 isoform X1 [Solanum lycopersicum] gi|723692754|ref|XP_010319849.1| PREDICTED: regulator of nonsense transcripts UPF2 isoform X1 [Solanum lycopersicum] gi|723692757|ref|XP_010319850.1| PREDICTED: regulator of nonsense transcripts UPF2 isoform X1 [Solanum lycopersicum] gi|723692760|ref|XP_010319851.1| PREDICTED: regulator of nonsense transcripts UPF2 isoform X1 [Solanum lycopersicum] Length = 1198 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/36 (69%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = -3 Query: 445 RVANRGRTWDGHGR-AGPRHRHLYHSGAGFYYGRRR 341 RVA+RG TWD GR +G RHR+L+HSG G YYGRRR Sbjct: 1163 RVAHRGSTWDAPGRGSGSRHRYLHHSGGGLYYGRRR 1198 >ref|XP_006340545.1| PREDICTED: regulator of nonsense transcripts UPF2 [Solanum tuberosum] gi|565347048|ref|XP_006340546.1| PREDICTED: regulator of nonsense transcripts UPF2 [Solanum tuberosum] gi|565347050|ref|XP_006340547.1| PREDICTED: regulator of nonsense transcripts UPF2 [Solanum tuberosum] Length = 1197 Score = 54.7 bits (130), Expect = 6e-06 Identities = 24/36 (66%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = -3 Query: 445 RVANRGRTWDGHGR-AGPRHRHLYHSGAGFYYGRRR 341 RV+ RG TWD GR +G RHR+L+HSG G YYGRRR Sbjct: 1162 RVSQRGSTWDAPGRGSGSRHRYLHHSGGGLYYGRRR 1197