BLASTX nr result
ID: Rehmannia28_contig00029464
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00029464 (365 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086030.1| PREDICTED: transcription factor VOZ1-like is... 82 4e-16 ref|XP_011086029.1| PREDICTED: transcription factor VOZ1-like is... 82 4e-16 ref|XP_011086027.1| PREDICTED: transcription factor VOZ1-like is... 82 4e-16 ref|XP_011096373.1| PREDICTED: transcription factor VOZ1 [Sesamu... 79 9e-15 emb|CDO99464.1| unnamed protein product [Coffea canephora] 57 3e-07 emb|CDO96711.1| unnamed protein product [Coffea canephora] 55 2e-06 ref|XP_008371423.1| PREDICTED: transcription factor VOZ1-like [M... 54 4e-06 ref|NP_001280853.1| uncharacterized protein LOC103434841 [Malus ... 54 4e-06 ref|XP_008245366.1| PREDICTED: transcription factor VOZ1 [Prunus... 54 6e-06 ref|XP_007025509.1| Vascular plant one zinc finger protein isofo... 53 8e-06 ref|XP_009352832.1| PREDICTED: transcription factor VOZ1-like is... 53 8e-06 ref|XP_009352831.1| PREDICTED: transcription factor VOZ1-like is... 53 8e-06 >ref|XP_011086030.1| PREDICTED: transcription factor VOZ1-like isoform X3 [Sesamum indicum] Length = 438 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = +3 Query: 3 LKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 131 +KDG G+ YS SNALASPGEGFDYVRGAPYDYLV NINGYYLT Sbjct: 396 MKDGMGSIYSASNALASPGEGFDYVRGAPYDYLVGNINGYYLT 438 >ref|XP_011086029.1| PREDICTED: transcription factor VOZ1-like isoform X2 [Sesamum indicum] Length = 477 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = +3 Query: 3 LKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 131 +KDG G+ YS SNALASPGEGFDYVRGAPYDYLV NINGYYLT Sbjct: 435 MKDGMGSIYSASNALASPGEGFDYVRGAPYDYLVGNINGYYLT 477 >ref|XP_011086027.1| PREDICTED: transcription factor VOZ1-like isoform X1 [Sesamum indicum] gi|747077776|ref|XP_011086028.1| PREDICTED: transcription factor VOZ1-like isoform X1 [Sesamum indicum] Length = 486 Score = 82.4 bits (202), Expect = 4e-16 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = +3 Query: 3 LKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 131 +KDG G+ YS SNALASPGEGFDYVRGAPYDYLV NINGYYLT Sbjct: 444 MKDGMGSIYSASNALASPGEGFDYVRGAPYDYLVGNINGYYLT 486 >ref|XP_011096373.1| PREDICTED: transcription factor VOZ1 [Sesamum indicum] Length = 454 Score = 78.6 bits (192), Expect = 9e-15 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = +3 Query: 3 LKDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 131 LKDGTGN YS SNAL SP EGFDY RGAPYDYLVD+I+ YYLT Sbjct: 412 LKDGTGNIYSASNALGSPAEGFDYARGAPYDYLVDDISAYYLT 454 >emb|CDO99464.1| unnamed protein product [Coffea canephora] Length = 485 Score = 57.4 bits (137), Expect = 3e-07 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = +3 Query: 6 KDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 131 KD G+ YS N + GEGF+Y GA Y+YLVDN+NGYY+T Sbjct: 444 KDAAGSIYSTPNRMPPTGEGFEYSTGASYEYLVDNLNGYYVT 485 >emb|CDO96711.1| unnamed protein product [Coffea canephora] Length = 354 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/40 (57%), Positives = 28/40 (70%) Frame = +3 Query: 6 KDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYY 125 KD G+ YS N + GEGF+Y GA Y+YLVDN+NGYY Sbjct: 292 KDAAGSIYSTPNRMPPTGEGFEYSTGASYEYLVDNLNGYY 331 >ref|XP_008371423.1| PREDICTED: transcription factor VOZ1-like [Malus domestica] gi|657959746|ref|XP_008371424.1| PREDICTED: transcription factor VOZ1-like [Malus domestica] gi|657959748|ref|XP_008371425.1| PREDICTED: transcription factor VOZ1-like [Malus domestica] Length = 483 Score = 53.9 bits (128), Expect = 4e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = +3 Query: 6 KDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 131 K GN Y N A+ FDY GAPYDYLVDN+NGYYLT Sbjct: 442 KVSVGNVYYAPNRGATTNGTFDYEIGAPYDYLVDNVNGYYLT 483 >ref|NP_001280853.1| uncharacterized protein LOC103434841 [Malus domestica] gi|295841593|dbj|BAJ07177.1| MdVOZ1 [Malus domestica] Length = 483 Score = 53.9 bits (128), Expect = 4e-06 Identities = 25/42 (59%), Positives = 27/42 (64%) Frame = +3 Query: 6 KDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 131 K GN Y N A+ FDY GAPYDYLVDN+NGYYLT Sbjct: 442 KVSVGNVYYAPNRGATTNGTFDYEIGAPYDYLVDNVNGYYLT 483 >ref|XP_008245366.1| PREDICTED: transcription factor VOZ1 [Prunus mume] gi|645280855|ref|XP_008245367.1| PREDICTED: transcription factor VOZ1 [Prunus mume] Length = 484 Score = 53.5 bits (127), Expect = 6e-06 Identities = 25/42 (59%), Positives = 28/42 (66%) Frame = +3 Query: 6 KDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 131 K G GN Y N A+ FDY GAPYDYLV+N+NGYYLT Sbjct: 443 KVGVGNVYYTPNRGATTNGTFDYGIGAPYDYLVENVNGYYLT 484 >ref|XP_007025509.1| Vascular plant one zinc finger protein isoform 1 [Theobroma cacao] gi|590624104|ref|XP_007025511.1| Vascular plant one zinc finger protein isoform 1 [Theobroma cacao] gi|508780875|gb|EOY28131.1| Vascular plant one zinc finger protein isoform 1 [Theobroma cacao] gi|508780877|gb|EOY28133.1| Vascular plant one zinc finger protein isoform 1 [Theobroma cacao] Length = 480 Score = 53.1 bits (126), Expect = 8e-06 Identities = 24/42 (57%), Positives = 27/42 (64%) Frame = +3 Query: 6 KDGTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 131 K G GN Y+ N +A E FDY G YDYLVDN+ GYYLT Sbjct: 439 KVGVGNLYATPNVVAPTSEKFDYGLGVQYDYLVDNLTGYYLT 480 >ref|XP_009352832.1| PREDICTED: transcription factor VOZ1-like isoform X2 [Pyrus x bretschneideri] gi|694323537|ref|XP_009352833.1| PREDICTED: transcription factor VOZ1-like isoform X2 [Pyrus x bretschneideri] Length = 484 Score = 53.1 bits (126), Expect = 8e-06 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = +3 Query: 12 GTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 131 G GN Y N A+ FDY GAPYDYL+D++NGYYLT Sbjct: 445 GVGNVYYSPNRGATTNATFDYGSGAPYDYLLDDVNGYYLT 484 >ref|XP_009352831.1| PREDICTED: transcription factor VOZ1-like isoform X1 [Pyrus x bretschneideri] Length = 493 Score = 53.1 bits (126), Expect = 8e-06 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = +3 Query: 12 GTGNTYSGSNALASPGEGFDYVRGAPYDYLVDNINGYYLT 131 G GN Y N A+ FDY GAPYDYL+D++NGYYLT Sbjct: 454 GVGNVYYSPNRGATTNATFDYGSGAPYDYLLDDVNGYYLT 493