BLASTX nr result
ID: Rehmannia28_contig00028905
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00028905 (309 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO79219.1| hypothetical protein CISIN_1g015425mg [Citrus sin... 53 6e-06 >gb|KDO79219.1| hypothetical protein CISIN_1g015425mg [Citrus sinensis] Length = 407 Score = 52.8 bits (125), Expect = 6e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = -1 Query: 309 SQAGALNRSEHSTFNSCKARLDSIYCAAA*PPFYYLDQTFVV 184 +QA LNRSEH TFNSCK RLDS+ + PPF L QTF+V Sbjct: 366 AQADLLNRSEHWTFNSCKDRLDSLILCCSLPPFCCLRQTFLV 407