BLASTX nr result
ID: Rehmannia28_contig00028693
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00028693 (532 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010558780.1| PREDICTED: ethylene-responsive transcription... 56 3e-06 gb|EPS71253.1| hypothetical protein M569_03507, partial [Genlise... 53 3e-06 dbj|BAF16413.2| Os05g0121600, partial [Oryza sativa Japonica Group] 53 5e-06 ref|XP_002437734.1| hypothetical protein SORBIDRAFT_10g001490 [S... 53 1e-05 ref|XP_008645602.1| PREDICTED: ethylene-responsive transcription... 52 1e-05 >ref|XP_010558780.1| PREDICTED: ethylene-responsive transcription factor RAP2-7-like isoform X1 [Tarenaya hassleriana] Length = 411 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/39 (69%), Positives = 28/39 (71%), Gaps = 3/39 (7%) Frame = +2 Query: 17 RRPPRSTLFPY---TTLFRSGRWESHIWDCGKQVYLGWF 124 RR PRS PY T R+GRWESHIWDCGKQVYLG F Sbjct: 125 RRGPRSRSSPYRGVTFYRRTGRWESHIWDCGKQVYLGGF 163 >gb|EPS71253.1| hypothetical protein M569_03507, partial [Genlisea aurea] Length = 110 Score = 53.1 bits (126), Expect = 3e-06 Identities = 26/39 (66%), Positives = 27/39 (69%), Gaps = 3/39 (7%) Frame = +2 Query: 17 RRPPRSTLFPY---TTLFRSGRWESHIWDCGKQVYLGWF 124 RR PRS Y T R+GRWESHIWDCGKQVYLG F Sbjct: 6 RRGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLGGF 44 >dbj|BAF16413.2| Os05g0121600, partial [Oryza sativa Japonica Group] Length = 130 Score = 53.1 bits (126), Expect = 5e-06 Identities = 26/39 (66%), Positives = 27/39 (69%), Gaps = 3/39 (7%) Frame = +2 Query: 17 RRPPRSTLFPY---TTLFRSGRWESHIWDCGKQVYLGWF 124 RR PRS Y T R+GRWESHIWDCGKQVYLG F Sbjct: 6 RRGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLGGF 44 >ref|XP_002437734.1| hypothetical protein SORBIDRAFT_10g001490 [Sorghum bicolor] Length = 169 Score = 53.1 bits (126), Expect = 1e-05 Identities = 26/39 (66%), Positives = 27/39 (69%), Gaps = 3/39 (7%) Frame = +2 Query: 17 RRPPRSTLFPY---TTLFRSGRWESHIWDCGKQVYLGWF 124 RR PRS Y T R+GRWESHIWDCGKQVYLG F Sbjct: 101 RRGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLGGF 139 >ref|XP_008645602.1| PREDICTED: ethylene-responsive transcription factor WRI1-like isoform X2 [Zea mays] Length = 131 Score = 52.4 bits (124), Expect = 1e-05 Identities = 26/53 (49%), Positives = 28/53 (52%), Gaps = 16/53 (30%) Frame = +2 Query: 14 IRRPPRSTLFPYTTLF----------------RSGRWESHIWDCGKQVYLGWF 124 + RPP FP TT R+GRWESHIWDCGKQVYLG F Sbjct: 24 VDRPPTQQFFPPTTTAAQQATSTAYRGVTFYRRTGRWESHIWDCGKQVYLGGF 76