BLASTX nr result
ID: Rehmannia28_contig00028486
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00028486 (730 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100335.1| PREDICTED: diacylglycerol kinase 5 [Sesamum ... 57 6e-06 ref|XP_012852471.1| PREDICTED: diacylglycerol kinase 5 [Erythran... 57 7e-06 >ref|XP_011100335.1| PREDICTED: diacylglycerol kinase 5 [Sesamum indicum] gi|747104224|ref|XP_011100336.1| PREDICTED: diacylglycerol kinase 5 [Sesamum indicum] Length = 486 Score = 57.0 bits (136), Expect = 6e-06 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = +3 Query: 3 NQSTYAKLGCSQGWFMASLFHPSSR*ACTFC 95 NQSTYAKLGCSQGWF ASLFHPSSR C Sbjct: 262 NQSTYAKLGCSQGWFFASLFHPSSRNIAQLC 292 >ref|XP_012852471.1| PREDICTED: diacylglycerol kinase 5 [Erythranthe guttata] gi|604305775|gb|EYU24863.1| hypothetical protein MIMGU_mgv1a005316mg [Erythranthe guttata] Length = 489 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = +3 Query: 3 NQSTYAKLGCSQGWFMASLFHPSSR*ACTFC 95 NQSTYAKLGCSQGWF ASLFHPSSR C Sbjct: 265 NQSTYAKLGCSQGWFAASLFHPSSRNIAQLC 295