BLASTX nr result
ID: Rehmannia28_contig00028274
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00028274 (350 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28277.1| hypothetical protein MIMGU_mgv1a017405mg [Erythra... 73 5e-15 >gb|EYU28277.1| hypothetical protein MIMGU_mgv1a017405mg [Erythranthe guttata] Length = 77 Score = 73.2 bits (178), Expect = 5e-15 Identities = 40/77 (51%), Positives = 48/77 (62%), Gaps = 2/77 (2%) Frame = +2 Query: 92 MSQRANRHQRRPSQGVFVIPDNLSXXXXXXXXXXXXXXXXXXXXQEKNSGGA-VHLPPQP 268 MS+RANRH+RRPSQGVFV+PDNLS QE+++GGA V LPPQP Sbjct: 1 MSERANRHRRRPSQGVFVLPDNLSDPLTDDIAHAPPAAQAPHPPQERSAGGAGVQLPPQP 60 Query: 269 P-AKAAEQMPTSDRTNK 316 P K AE+ P DR+ K Sbjct: 61 PQPKRAEEKPNPDRSGK 77