BLASTX nr result
ID: Rehmannia28_contig00028124
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00028124 (458 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012834839.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 64 4e-09 ref|XP_011084681.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-07 >ref|XP_012834839.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Erythranthe guttata] Length = 767 Score = 63.9 bits (154), Expect = 4e-09 Identities = 36/63 (57%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = +2 Query: 269 MLLIRKLSGRPTVNYILHSFLGKISKCPCVAGRAH-KSFTDLHGQNGISTFRHGFKHFSH 445 M L RKLS R T NYILH F + SKCPCVA R H KSF+ + QN +STF + H S+ Sbjct: 1 MSLTRKLSLRATANYILHRF-SRNSKCPCVANRYHHKSFSHSYSQNSVSTFCLKYGHPSN 59 Query: 446 NFT 454 NFT Sbjct: 60 NFT 62 >ref|XP_011084681.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Sesamum indicum] gi|747075306|ref|XP_011084682.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03100, mitochondrial [Sesamum indicum] Length = 770 Score = 59.3 bits (142), Expect = 1e-07 Identities = 31/61 (50%), Positives = 40/61 (65%) Frame = +2 Query: 272 LLIRKLSGRPTVNYILHSFLGKISKCPCVAGRAHKSFTDLHGQNGISTFRHGFKHFSHNF 451 +L RKLS + NYILHS LG+ISKCP VA R H S + Q+ +S R G + FS+NF Sbjct: 1 MLTRKLSRQLAANYILHS-LGRISKCPRVANRGHNSISHFFWQSSVSECRDGLELFSNNF 59 Query: 452 T 454 + Sbjct: 60 S 60