BLASTX nr result
ID: Rehmannia28_contig00027999
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00027999 (405 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070890.1| PREDICTED: probable sodium-coupled neutral a... 61 2e-08 gb|EYU22587.1| hypothetical protein MIMGU_mgv1a005864mg [Erythra... 54 8e-06 ref|XP_012855376.1| PREDICTED: probable sodium-coupled neutral a... 54 8e-06 >ref|XP_011070890.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6 [Sesamum indicum] gi|747049675|ref|XP_011070891.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6 [Sesamum indicum] Length = 471 Score = 60.8 bits (146), Expect = 2e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 404 VFMVGLAVFASLVAIYSDAYAIFSRNASPSRE 309 VFMVGLAVFASLVAIYSDAYAIF +NASPSRE Sbjct: 440 VFMVGLAVFASLVAIYSDAYAIFKKNASPSRE 471 >gb|EYU22587.1| hypothetical protein MIMGU_mgv1a005864mg [Erythranthe guttata] Length = 467 Score = 53.5 bits (127), Expect = 8e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 404 VFMVGLAVFASLVAIYSDAYAIFSRNASPSR 312 VFMVGLAVFA+ VAIYSDAYAIF +N SPSR Sbjct: 437 VFMVGLAVFANSVAIYSDAYAIFRKNVSPSR 467 >ref|XP_012855376.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6 [Erythranthe guttata] Length = 471 Score = 53.5 bits (127), Expect = 8e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 404 VFMVGLAVFASLVAIYSDAYAIFSRNASPSR 312 VFMVGLAVFA+ VAIYSDAYAIF +N SPSR Sbjct: 441 VFMVGLAVFANSVAIYSDAYAIFRKNVSPSR 471