BLASTX nr result
ID: Rehmannia28_contig00027986
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00027986 (381 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077041.1| PREDICTED: uncharacterized protein LOC105161... 53 2e-06 ref|XP_012833197.1| PREDICTED: uncharacterized protein LOC105954... 52 4e-06 >ref|XP_011077041.1| PREDICTED: uncharacterized protein LOC105161139 [Sesamum indicum] gi|747042174|ref|XP_011077049.1| PREDICTED: uncharacterized protein LOC105161139 [Sesamum indicum] Length = 122 Score = 52.8 bits (125), Expect = 2e-06 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 8/44 (18%) Frame = +1 Query: 274 MSMVKWKEDEIS--------KGGRPPRTTLAAIESLAMPLVQEV 381 MS+V+WK+D+++ KG RP RTTLAA+ESLA+PLVQEV Sbjct: 1 MSLVRWKKDDLTTMTATTGVKGSRPDRTTLAAVESLAVPLVQEV 44 >ref|XP_012833197.1| PREDICTED: uncharacterized protein LOC105954074 [Erythranthe guttata] gi|604341636|gb|EYU40882.1| hypothetical protein MIMGU_mgv1a016662mg [Erythranthe guttata] Length = 112 Score = 51.6 bits (122), Expect = 4e-06 Identities = 27/40 (67%), Positives = 31/40 (77%), Gaps = 4/40 (10%) Frame = +1 Query: 274 MSMVKWKEDEI----SKGGRPPRTTLAAIESLAMPLVQEV 381 MSMV WK+DE+ KG R P TTLAA+ESLA+PLVQEV Sbjct: 1 MSMVGWKKDEVFKAGPKGARRPGTTLAAVESLAVPLVQEV 40