BLASTX nr result
ID: Rehmannia28_contig00027943
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00027943 (401 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP59195.1| hypothetical protein KK1_014627 [Cajanus cajan] 67 2e-14 gb|KYP76032.1| Retrovirus-related Pol polyprotein from transposo... 66 6e-14 gb|KYP52235.1| Copia protein [Cajanus cajan] 62 8e-14 gb|KYP70981.1| Retrovirus-related Pol polyprotein from transposo... 58 6e-13 gb|KYP78991.1| Copia protein [Cajanus cajan] 70 6e-13 gb|KYP74315.1| Copia protein [Cajanus cajan] 69 7e-13 gb|KYP70034.1| Copia protein [Cajanus cajan] 69 7e-13 gb|KYP32609.1| Copia protein [Cajanus cajan] 69 7e-13 gb|KYP64096.1| Copia protein [Cajanus cajan] 59 1e-12 gb|KYP63463.1| Retrovirus-related Pol polyprotein from transposo... 58 1e-12 gb|KYP59731.1| Copia protein, partial [Cajanus cajan] 58 1e-12 gb|KYP69952.1| Copia protein [Cajanus cajan] 58 1e-12 gb|KYP70035.1| Copia protein [Cajanus cajan] 58 1e-12 gb|KYP48844.1| Copia protein, partial [Cajanus cajan] gi|1012350... 58 2e-12 emb|CAN74310.1| hypothetical protein VITISV_037517 [Vitis vinifera] 61 2e-12 gb|KYP63859.1| Copia protein [Cajanus cajan] 67 2e-12 emb|CAN71418.1| hypothetical protein VITISV_042084 [Vitis vinifera] 62 2e-12 emb|CAN62924.1| hypothetical protein VITISV_033234 [Vitis vinifera] 60 2e-12 gb|KYP55562.1| Copia protein [Cajanus cajan] 58 3e-12 emb|CAN69286.1| hypothetical protein VITISV_028682 [Vitis vinifera] 61 3e-12 >gb|KYP59195.1| hypothetical protein KK1_014627 [Cajanus cajan] Length = 273 Score = 67.0 bits (162), Expect(2) = 2e-14 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = +3 Query: 57 SSHFTRDQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 SS +++DQLADIFTKSLRGP ITYIC+K+DAYD+YAP Sbjct: 236 SSVYSKDQLADIFTKSLRGPSITYICNKLDAYDIYAP 272 Score = 38.5 bits (88), Expect(2) = 2e-14 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +1 Query: 1 TKHTEVDCHFVRTKVLSKEVVTSHV 75 TKH EVDCHF+R K+LS + TS V Sbjct: 214 TKHIEVDCHFIREKILSSIIKTSSV 238 >gb|KYP76032.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1355 Score = 65.9 bits (159), Expect(2) = 6e-14 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 57 SSHFTRDQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 SS ++DQLADIFTKSLRGPRITYIC+K+D YD+YAP Sbjct: 1318 SSVCSKDQLADIFTKSLRGPRITYICNKLDVYDIYAP 1354 Score = 38.1 bits (87), Expect(2) = 6e-14 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +1 Query: 1 TKHTEVDCHFVRTKVLSKEVVTSHV 75 TKH EVDCHF+R K+LS + TS V Sbjct: 1296 TKHIEVDCHFIREKILSDIIKTSSV 1320 >gb|KYP52235.1| Copia protein [Cajanus cajan] Length = 397 Score = 62.4 bits (150), Expect(2) = 8e-14 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +3 Query: 75 DQLADIFTKSLRGPRITYICDKMDAYDVYAPP*GGELE 188 DQLAD+FTKSL+GPR+ YIC+K+ AYD+YAP GG L+ Sbjct: 358 DQLADVFTKSLKGPRVDYICNKLGAYDIYAPAWGGVLQ 395 Score = 41.2 bits (95), Expect(2) = 8e-14 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = +1 Query: 1 TKHTEVDCHFVRTKVLSKEVVTSHVINS 84 TKH E+DCHFVR KVLS E+ T V +S Sbjct: 330 TKHIEIDCHFVREKVLSGEITTEFVHSS 357 >gb|KYP70981.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 388 Score = 58.2 bits (139), Expect(2) = 6e-13 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 75 DQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 DQLAD+FTKSL+GPR+ YIC+K+ AYD+YAP Sbjct: 357 DQLADVFTKSLKGPRVDYICNKLGAYDIYAP 387 Score = 42.4 bits (98), Expect(2) = 6e-13 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = +1 Query: 1 TKHTEVDCHFVRTKVLSKEVVTSHVINS 84 TKH E+DCHF+R KVLS+E+ T V +S Sbjct: 329 TKHIEIDCHFIREKVLSREITTKFVHSS 356 >gb|KYP78991.1| Copia protein [Cajanus cajan] Length = 134 Score = 70.1 bits (170), Expect = 6e-13 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +3 Query: 42 GAI*GSSHFTRDQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 G I SS F++DQLADIFTKSL+GPRITYIC+K+DAYD+YAP Sbjct: 92 GIIKTSSVFSKDQLADIFTKSLQGPRITYICNKLDAYDIYAP 133 >gb|KYP74315.1| Copia protein [Cajanus cajan] Length = 82 Score = 68.6 bits (166), Expect = 7e-13 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +3 Query: 42 GAI*GSSHFTRDQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 G I SS ++DQLADIFTKSLRGPRITYIC+K+DAYD+YAP Sbjct: 40 GIIKTSSVCSKDQLADIFTKSLRGPRITYICNKLDAYDIYAP 81 >gb|KYP70034.1| Copia protein [Cajanus cajan] Length = 82 Score = 68.6 bits (166), Expect = 7e-13 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +3 Query: 42 GAI*GSSHFTRDQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 G I SS ++DQLADIFTKSLRGPRITYIC+K+DAYD+YAP Sbjct: 40 GIIKTSSVCSKDQLADIFTKSLRGPRITYICNKLDAYDIYAP 81 >gb|KYP32609.1| Copia protein [Cajanus cajan] Length = 82 Score = 68.6 bits (166), Expect = 7e-13 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +3 Query: 42 GAI*GSSHFTRDQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 G I SS ++DQLADIFTKSLRGPRITYIC+K+DAYD+YAP Sbjct: 40 GIIKTSSVCSKDQLADIFTKSLRGPRITYICNKLDAYDIYAP 81 >gb|KYP64096.1| Copia protein [Cajanus cajan] Length = 314 Score = 58.5 bits (140), Expect(2) = 1e-12 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 75 DQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 DQLAD+FTKSL+GPR+ YIC+K+ AYD+YAP Sbjct: 283 DQLADVFTKSLKGPRVNYICNKLGAYDIYAP 313 Score = 41.2 bits (95), Expect(2) = 1e-12 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = +1 Query: 1 TKHTEVDCHFVRTKVLSKEVVTSHVINS 84 TKH E+DCHFVR KVLS E+ T V +S Sbjct: 255 TKHIEIDCHFVREKVLSGEITTKFVRSS 282 >gb|KYP63463.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 402 Score = 58.2 bits (139), Expect(2) = 1e-12 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 75 DQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 DQLAD+FTKSL+GPR+ YIC+K+ AYD+YAP Sbjct: 371 DQLADVFTKSLKGPRVDYICNKLGAYDIYAP 401 Score = 41.2 bits (95), Expect(2) = 1e-12 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = +1 Query: 1 TKHTEVDCHFVRTKVLSKEVVTSHVINS 84 TKH E+DCHFVR KVLS E+ T V +S Sbjct: 343 TKHIEIDCHFVREKVLSGEITTEFVHSS 370 >gb|KYP59731.1| Copia protein, partial [Cajanus cajan] Length = 268 Score = 58.2 bits (139), Expect(2) = 1e-12 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 75 DQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 DQLAD+FTKSL+GPR+ YIC+K+ AYD+YAP Sbjct: 237 DQLADVFTKSLKGPRVDYICNKLGAYDIYAP 267 Score = 41.2 bits (95), Expect(2) = 1e-12 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = +1 Query: 1 TKHTEVDCHFVRTKVLSKEVVTSHVINS 84 TKH E+DCHFVR KVLS E+ T V +S Sbjct: 209 TKHIEIDCHFVREKVLSGEITTEFVHSS 236 >gb|KYP69952.1| Copia protein [Cajanus cajan] Length = 243 Score = 58.2 bits (139), Expect(2) = 1e-12 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 75 DQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 DQLAD+FTKSL+GPR+ YIC+K+ AYD+YAP Sbjct: 212 DQLADVFTKSLKGPRVDYICNKLGAYDIYAP 242 Score = 41.2 bits (95), Expect(2) = 1e-12 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = +1 Query: 1 TKHTEVDCHFVRTKVLSKEVVTSHVINS 84 TKH E+DCHFVR KVLS E+ T V +S Sbjct: 184 TKHIEIDCHFVREKVLSGEITTEFVHSS 211 >gb|KYP70035.1| Copia protein [Cajanus cajan] Length = 183 Score = 58.2 bits (139), Expect(2) = 1e-12 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 75 DQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 DQLAD+FTKSL+GPR+ YIC+K+ AYD+YAP Sbjct: 152 DQLADVFTKSLKGPRVDYICNKLGAYDIYAP 182 Score = 41.2 bits (95), Expect(2) = 1e-12 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = +1 Query: 1 TKHTEVDCHFVRTKVLSKEVVTSHVINS 84 TKH E+DCHFVR KVLS E+ T V +S Sbjct: 124 TKHIEIDCHFVREKVLSGEITTEFVHSS 151 >gb|KYP48844.1| Copia protein, partial [Cajanus cajan] gi|1012350268|gb|KYP61457.1| Copia protein, partial [Cajanus cajan] Length = 87 Score = 58.2 bits (139), Expect(2) = 2e-12 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 75 DQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 DQLAD+FTKSL+GPR+ YIC+K+ AYD+YAP Sbjct: 56 DQLADVFTKSLKGPRVDYICNKLGAYDIYAP 86 Score = 41.2 bits (95), Expect(2) = 2e-12 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = +1 Query: 1 TKHTEVDCHFVRTKVLSKEVVTSHVINS 84 TKH E+DCHFVR KVLS E+ T V +S Sbjct: 28 TKHIEIDCHFVREKVLSGEITTEFVHSS 55 >emb|CAN74310.1| hypothetical protein VITISV_037517 [Vitis vinifera] Length = 1266 Score = 60.8 bits (146), Expect(2) = 2e-12 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 69 TRDQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 + DQLADIFTKSLRGPRI YIC+K+ AYDVYAP Sbjct: 1233 SNDQLADIFTKSLRGPRIKYICNKLGAYDVYAP 1265 Score = 38.1 bits (87), Expect(2) = 2e-12 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +1 Query: 1 TKHTEVDCHFVRTKVLSKEVVTSHV 75 TKH EVDCHF+R K+ S+ V TS V Sbjct: 1207 TKHIEVDCHFIREKIASRCVATSFV 1231 >gb|KYP63859.1| Copia protein [Cajanus cajan] Length = 82 Score = 67.4 bits (163), Expect = 2e-12 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +3 Query: 42 GAI*GSSHFTRDQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 G I S+ ++DQLADIFTKSLRGPRITYIC+K+DAYD+YAP Sbjct: 40 GIIKTSAICSKDQLADIFTKSLRGPRITYICNKLDAYDIYAP 81 >emb|CAN71418.1| hypothetical protein VITISV_042084 [Vitis vinifera] Length = 107 Score = 62.0 bits (149), Expect(2) = 2e-12 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 69 TRDQLADIFTKSLRGPRITYICDKMDAYDVYAPP 170 + DQLADIFTKSL+GPRI YIC+K+ AYD+YAPP Sbjct: 74 SNDQLADIFTKSLKGPRIKYICNKLGAYDIYAPP 107 Score = 36.6 bits (83), Expect(2) = 2e-12 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +1 Query: 1 TKHTEVDCHFVRTKVLSKEVVTSHV 75 TKH EVDCHF+R K+ S V TS V Sbjct: 48 TKHIEVDCHFIREKITSGCVATSFV 72 >emb|CAN62924.1| hypothetical protein VITISV_033234 [Vitis vinifera] Length = 107 Score = 60.5 bits (145), Expect(2) = 2e-12 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 69 TRDQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 + DQLADIFTKSLRGPRI YIC+K+ AYD+YAP Sbjct: 74 SNDQLADIFTKSLRGPRIKYICNKLGAYDIYAP 106 Score = 38.1 bits (87), Expect(2) = 2e-12 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +1 Query: 1 TKHTEVDCHFVRTKVLSKEVVTSHV 75 TKH EVDCHF+R K+ S+ V TS V Sbjct: 48 TKHIEVDCHFIREKIASRCVATSFV 72 >gb|KYP55562.1| Copia protein [Cajanus cajan] Length = 101 Score = 58.2 bits (139), Expect(2) = 3e-12 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +3 Query: 75 DQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 DQLAD+FTKSL+GPR+ YIC+K+ AYD+YAP Sbjct: 70 DQLADVFTKSLKGPRVDYICNKLGAYDIYAP 100 Score = 40.4 bits (93), Expect(2) = 3e-12 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = +1 Query: 1 TKHTEVDCHFVRTKVLSKEVVTSHVINS 84 TKH E+DCHFVR KVLS E+ T V +S Sbjct: 42 TKHIEIDCHFVREKVLSGEISTEFVHSS 69 >emb|CAN69286.1| hypothetical protein VITISV_028682 [Vitis vinifera] Length = 82 Score = 61.2 bits (147), Expect(2) = 3e-12 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 69 TRDQLADIFTKSLRGPRITYICDKMDAYDVYAP 167 + DQLADIFTKSLRGPRI YIC+K+DAY++YAP Sbjct: 49 SNDQLADIFTKSLRGPRIKYICNKLDAYNIYAP 81 Score = 37.4 bits (85), Expect(2) = 3e-12 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +1 Query: 1 TKHTEVDCHFVRTKVLSKEVVTSHV 75 TKH EVDCHF+R K+ S V TS V Sbjct: 23 TKHIEVDCHFIREKITSGYVATSFV 47